SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0143394 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0143394
Domain Number 1 Region: 1920-2136
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.22e-26
Family Laminin G-like module 0.012
Further Details:      
 
Domain Number 2 Region: 1596-1639,1705-1861
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.18e-25
Family Laminin G-like module 0.0023
Further Details:      
 
Domain Number 3 Region: 1023-1252
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.76e-25
Family Laminin G-like module 0.00067
Further Details:      
 
Domain Number 4 Region: 1309-1518
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.27e-23
Family Laminin G-like module 0.0024
Further Details:      
 
Domain Number 5 Region: 208-250
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000962
Family EGF-type module 0.0051
Further Details:      
 
Domain Number 6 Region: 288-326
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000143
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 7 Region: 170-212
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000474
Family EGF-type module 0.0041
Further Details:      
 
Domain Number 8 Region: 248-293
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000786
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 9 Region: 328-370
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000126
Family EGF-type module 0.01
Further Details:      
 
Domain Number 10 Region: 135-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000471
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 11 Region: 1252-1300
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000571
Family EGF-type module 0.034
Further Details:      
 
Domain Number 12 Region: 1534-1575
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000162
Family EGF-type module 0.016
Further Details:      
 
Domain Number 13 Region: 363-402
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000018
Family EGF-type module 0.0091
Further Details:      
 
Weak hits

Sequence:  FBpp0143394
Domain Number - Region: 1865-1901
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0297
Family EGF-type module 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0143394   Gene: FBgn0116978   Transcript: FBtr0144902
Sequence length 2163
Comment type=protein; loc=scaffold_4929:join(2358158..2358612,2361764..2361912,2377399..2377551,2377748..2380074,2385590..2385942,2389591..2389863,2391354..2391646,2391766..2392426,2392499..2392662,2392759..2393490,2393616..2393858,2395605..2396105,2396837..2397024); ID=FBpp0143394; name=Dere\GG24848-PA; parent=FBgn0116978,FBtr0144902; dbxref=FlyBase:FBpp0143394,FlyBase_Annotation_IDs:GG24848-PA,GB_protein:EDV57458,REFSEQ:XP_001968399,FlyMine:FBpp0143394; MD5=3e27b45cae6592af371819b16c307bc4; length=2163; release=r1.3; species=Dere;
Sequence
MAESPQIERDMGRRCAALPSKDSEDGAGTALGAATPLTANGATTTGLSVTLAPKDMQRNH
LLKMPTPTIEKPTITATIASSSSSNSTTRKSATATRSLNSNPNILLPTLRILARGVLLPV
LILAILVGSSQAGFACLSNPCVFGVCIDGLNSSYSCYCIDGYTGIQCQTNWDECWSSPCQ
NGGTCVDGVAYYNCTCPEGFSGSNCEENVDECMSNPCQNGGLCRDRTNGYICTCQPGYLG
SHCELDVAVCETGTGARCQHGGECIEGPGLEFTCDCPAGWHGRICQEEINECASSPCQNG
GVCVDKLAAYACACPMGYTGINCEEEILICADNPCQNNALCLMEEGVPTCYCVPDYHGEK
CEYQYDECQLGPRCMNGGVCIDGVDTFSCSCPPLLTGMLCECLMVGEESLDCNYTAPATQ
APPRRTTTTSTMAPPTVRPVTPPETTVPPPIVSEEVEIIVVTTSAPAEVVTSVLSPSSSS
SSEEGVSVEIKTMTVAPPESDSHSISVEQTTAVPAQPEPGSESEQEPEPKPQPGSDSESE
TEEEIIPGTTARPPASRSSSSSEESPSIFTTLPPLPGKPQTSASSESSGEVVTSEEYTTV
PHFEVSGSKSGSGSEEVTTVRPTAAPSITISVDITSSGSSSSSESVEVVTTPAPVFVQRV
TTIETSISIDYVTPTPLPETTTRGVVPMPRPTFAPEPPLDVVETTASTHHLWTEVPTTAA
PFFTEYPAEVLITTHRTSAGRFTTVQPPAGVTTTAPTEDSSVELPTPHTPQIVVTILDSN
EAIPSLITTTGVPTTHHHHHHHSHHAAEGTTLQPLEEDEHHHHHHHDVVTTPPQPVEITT
GHPLQTEDLIGVQEPAVLTTEGPFVPAETTVVPVVVPATIAPLGTVAPPATTAPVPPATT
APPPPPTPPSLATEQPTLPPTLRPVTMPPVTLPPPTIQPTPPSTQSAQTLPPPTSAINVY
TTPEGPPTASQTKPSVTESSEEVEGTNTVSSGGRGSGGVPEEKAGDVDCIKLGCYNGGTC
VTTSEGSRCVCRFDRQGPLCELPIIIRNAAFSGDSYVSHRIYKDIGGHESLDAVLPMHIQ
LKVRTRATNGLIMLAAAQGTKGGHYMALFLQKGLMQFQFSCGLQTMLLSELETPVNTGHE
ITIRAELDFSRNYTHCNASLLVNDTLAMSGDQPTWLKLLPPRLHTPEAILNTWLHLGGAP
QAPIGLIIELPPAQSGTGFTGCLHTLRINGQAREIFGDALDGFGITECGSLACLSSPCRN
GAACIKIETNDLDENGEKAEKWKCKCPTGYMGPTCEISVCEDNPCQYGGTCVQFPGSGYL
CLCPLGKHGHYCEHNLEVALPSFSGSVNGLSSFVAYTVPIPLEYSLELSFKILPQTMSQI
SLLAFFGQSGYHDEKSDHLAVSFIQGYIMLTWNLGAGPRRIFTQKPIDFRLDAPRVPYEI
KVGRIGRQAWLSVDGKFNITGRSPGSGSRMDVLPILYLGGHEIANFNTLPHDLPLHSGFQ
GCIYDVQLKAGQVTVPLQETRGVRGRGVGQCGTRECHRHACQHDGACLQHGATFTCICQE
GWYGPLCAQPTNPCDSFNNKCYEDATCVPLVNGYECDCPVGRTGKNCEEVIRSLSDVSLT
GRRSYLAVRWPYLYDGGDKLGAKRSQMVSYRNFTKKLMPPKPVTTPSTHFVMKLLNEVEK
QRSFSPVPLMGSKSFEEHHRVQFFFIEFQLRPLSERGLLLYFGTLNNNQDKKIGFVSLSL
QGGVVEFRISGPSNHVTVVRSVRMLAIGEWHKIKMAQRGRWLTLWVEGSASSALAPSAEV
LVEPDSLLYIGGLKDVSKLPHNAISGFPIPFRGCVRGLVVSGTRIVLNETNIVESRNIRD
CDGTACGGDSCESGGHCWLDEKLQPHCICPEYAKGDRCEYSETCKLIPCKNNGRCLRSGR
CSCPNGWGGFYCEIAMSKPTTPSFRGNSYLILPPPRIPMKDKRRGPSLYVRPREAIQVSL
NFSTIEPDGLLLWSEHERSKFLGLGLEAGHLKLASNLLGSTNDTVRAPASGFIADGAWHW
TSVLLDRTRLELQLDGEVIFTERLPEAGRSLGSTTPRTTLAGRRKNSSKEPTISYEDVFY
LGGFPNSDSVSRRTKGRFFDPFKGCLQDIQFGAEPTAIISDFSTYQGENIGSCDLHGDEP
LTV
Download sequence
Identical sequences FBpp0143394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]