SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0143439 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0143439
Domain Number 1 Region: 389-447
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000003
Family Variant RING domain 0.0081
Further Details:      
 
Weak hits

Sequence:  FBpp0143439
Domain Number - Region: 47-75
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00144
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0143439   Gene: FBgn0117022   Transcript: FBtr0144947
Sequence length 562
Comment type=protein; loc=scaffold_4929:join(2911662..2912096,2912160..2912255,2912999..2913408,2913480..2913896,2913956..2914286); ID=FBpp0143439; name=Dere\GG24893-PA; parent=FBgn0117022,FBtr0144947; dbxref=FlyBase:FBpp0143439,FlyBase_Annotation_IDs:GG24893-PA,GB_protein:EDV57542,REFSEQ:XP_001968483,FlyMine:FBpp0143439; MD5=95f00ddf884778ecf77670f4c48756a3; length=562; release=r1.3; species=Dere;
Sequence
MLPSLDTLMRCSKRVLQSPLEAAASQMRNGHSKSAAGGIYGPFSPDNDLSCSGRGDCVNN
TCVCDIRYAGNECDIFNLPYYAGISAVFYVVALVSLIQLFICIVAEYQRLKQPSVLRACR
ITTQKLLYFMVFVAASLRGAYFTTPLDLQPQWAVNLMSAYYPLLMTCASLIVCMWAEIFH
LRDIRWEKSQFLSKSFLGFVAFNFFLYSLYGIEVINSIINSEREDYAHIFNGCYAVLLLI
VVVFFLIYGVEVFFKLRGGFVYDQTGKILGPSEAIVNASQLHQSRFGLLSQAIMLIVIVG
FLASETLGDFWKTKVPVNSRNWHDIIFRIAEIGVALWFPCCLWNSMAPEQLWILNPRKLL
SRQIDPSIPTLNAETNKLSPEEGQSFLTKKDCWICYDSDKPEPLIQPCRCTGDVSSVHHE
CLKRWLVESCSNSEAQLSCKVCGHPYEIEKSKKLEWDKGFTIQHWSKTVIFITLMCVTGA
IAWVVIQMYVDPLVRVMTVGIAVLIAYVCVKCLGENTVVAYQRAKVSSINIVTSSEMEKL
HTICEEVSASTSAEAIRAGAAS
Download sequence
Identical sequences B3NA79
XP_001968483.1.56816 XP_015015278.1.56816 XP_015015279.1.56816 FBpp0143439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]