SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0129702 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0129702
Domain Number 1 Region: 488-556
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000068
Family Ankyrin repeat 0.0035
Further Details:      
 
Domain Number 2 Region: 646-746
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000122
Family Fibronectin type III 0.0071
Further Details:      
 
Weak hits

Sequence:  FBpp0129702
Domain Number - Region: 1545-1628
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0005
Family Ras-binding domain, RBD 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0129702   Gene: FBgn0103457   Transcript: FBtr0131210
Sequence length 1644
Comment type=protein; loc=scaffold_4820:complement(9569041..9571510,9571573..9571783,9571841..9572047,9572307..9572531,9572594..9572731,9572792..9572895,9572960..9573038,9573165..9573719,9574400..9574674,9575753..9576423); ID=FBpp0129702; name=Dere\GG11156-PA; parent=FBgn0103457,FBtr0131210; dbxref=FlyBase:FBpp0129702,FlyBase_Annotation_IDs:GG11156-PA,GB_protein:EDV54112,REFSEQ:XP_001982242,FlyMine:FBpp0129702; MD5=02f0e6940d38951a5779e3e9d39952ba; length=1644; release=r1.3; species=Dere;
Sequence
MERRKALSSYAKFKDHQEAAAAVTPQKDNESEDSLPALRRSHSVRSSLRRLKNKLHSPAL
PMQSPFKLRTQLHMRSRSSRGSATLNKSKAAKALRMLGDLDAVAVLTTKVKGKNEFVPLK
RAMNSESCDQDELGIERLMSTLPVGARLPRKACKLLQIPENYCRQTELAPKATLDSDLEN
TLSGEESSSVLADITRHAQQGIYGTTRMRTATIRKPMPYLNSRRCYHSDSTKLPNMPQKL
PMSSCLRSPAVFVRQKSFHTLNELTRFCQLKVSPHRATATATATATSSATSASSSPSSSP
AAAQQQRRHSHYAIDDNILPQDKRDGDIDSVRLREKVVNPSGGNNNNQDNYPTYYPAPLL
STSRWSEQLTQHAAVAKIRTAISCHSQDLKEMEFLLPHSRTEPQSNSQSQLCISRHSQPK
NAKLRDDHDETGSSELDSPPLGDENASANGQLSVHRQPIQLRNKNPGDTPHPRTNKMSKK
QLKLAQAQLDKLTQNNLHLHALFSAVEHGHLEKARTILESTDVDVNSINNDGLSALDLAV
LSNNRSMTRMLLQHGAVEGSQFSVDTIGTKLNGLLKDAESRIHDLSGPEGLCPPVFASRP
SISSIIIGNSSASVTGCTGSEVEKQIGIWERRVKGLRRLQLGWDQARPPDAPASVVVDVT
GDNSISVQILEPFEGAIGTKFKVQWSTRADFNNVVGESELLEWISFHGTMGAQCHISGLT
QGRRYFLRSACGNVKGWGAYRTSVPASVVPSTWRDLDNREDRFVGRHRILDNLFTAVRLA
RPADVSELTLDPASAQRRNPKKKTTIKQLFSVTTKFQKTLRRGIYFSCIIHCDDKVLVTS
EDFPPVIEVDESYPSALHMDYYWLMKVACTWEDVKSLRSDMERNLTSAVHFRTKLLSAVC
QMQSALGITDLGQLYYKPLRDAQGTVVLTCVQSVKSQKAVSILNSRWVPVSKLQKKLGAL
HEDYTINELLISSIGDQLHYQQAALQRLEPGLYLGYLKMQCSMDQIQVVVPVKTPNVLPH
CKVRENSHITAEEWQVLHRCSSDPLRLPLDFSAQGGDAASGGAATTEVQRLFLYDLTNAM
HKLFASMNIKIADATTHRLYDVEVIEHSPDISFLVVCPSAESSCAVPGQSELLLQRDDLA
SLSIQAFEMIHLRTYQPAIIQKYARLSCILELDTALATHSLREAFSSSELQAAKERLATL
QELSASLTIVWKSVRWLMDVVAYARNKNAQPSLAMREILDFAQQRHDESVATSAGGSANK
QLLQLPIRESKFSKTGQGRGSWPGPGTSEDQSQNKPEHSKSEQNLELSAITPVEPATKQV
PTQQQPQQQSQQQLLQVSNISEYAGSICSEVSLRKNSGDSMSSTYTSRSFYSAVDSASDG
NSTNSVFAIPPSRSDDTLADALRHSQAVAAQRKRTSSNIASHTNPLITVHSSSSAPYLAG
SSVSLRSGNGAFATDLEHKPLKPATKAASSANLREGGPYLKSTLAELRAVGGEEPVASTS
KASSMKSLSRQSSEEDSASCSSLNAEQTSGIIQVYTAYSTGLASGTSLKIHVTPKTTARE
VINLVVKQLNMAVVLKGNNGPIYGPEMLENFCLVAVIGARERCLRDDFKPLQLQNPWKKG
RLYVRKKHELLAAIEHSNRKSHLI
Download sequence
Identical sequences B3P8L7
FBpp0129702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]