SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0129859 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0129859
Domain Number 1 Region: 525-723
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.05e-54
Family Astacin 0.0000807
Further Details:      
 
Domain Number 2 Region: 1166-1274
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-37
Family Spermadhesin, CUB domain 0.00035
Further Details:      
 
Domain Number 3 Region: 852-955
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.13e-36
Family Spermadhesin, CUB domain 0.00032
Further Details:      
 
Domain Number 4 Region: 1000-1115
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.36e-32
Family Spermadhesin, CUB domain 0.00036
Further Details:      
 
Domain Number 5 Region: 1274-1394
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.5e-28
Family Spermadhesin, CUB domain 0.00064
Further Details:      
 
Domain Number 6 Region: 720-844
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-24
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 7 Region: 1115-1158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000529
Family EGF-type module 0.01
Further Details:      
 
Domain Number 8 Region: 953-998
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000016
Family EGF-type module 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0129859   Gene: FBgn0103614   Transcript: FBtr0131367
Sequence length 1467
Comment type=protein; loc=scaffold_4820:complement(7484306..7484629,7484689..7484951,7485014..7485194,7485312..7485955,7486666..7486871,7486956..7487220,7487306..7487504,7487570..7488128,7488199..7488438,7488895..7489179,7489515..7489936,7490128..7490486,7502527..7502983); ID=FBpp0129859; name=Dere\GG11313-PA; parent=FBgn0103614,FBtr0131367; dbxref=FlyBase:FBpp0129859,FlyBase_Annotation_IDs:GG11313-PA,GB_protein:EDV53818,REFSEQ:XP_001981948,FlyMine:FBpp0129859; MD5=7bd770763ad1318c818b8b3fa991a28c; length=1467; release=r1.3; species=Dere;
Sequence
MRRRRGTPLGVSWTNCVLLLATGLLVVLISVHAKNPRPHRGLPAPAPAPVPASVDQVATE
NGHGREPTVDGSVLQRLSGSKTTMDEDENGDEDENEGLRHQHLEHRQQFDAYLGTIRRLR
RPYRSKYTIEQLMRLHVTPKVSGDIDMDPCKAGGFMGDIALPEGDSGPVVAHTPIDDEEQ
ERQEVEQLLADSPSPVHDPAPASASVSGPANSGPTKFNATFQLDLEKLKQEVYHEGLQVE
EEGLTDIIRKKTKLPSSGPLNQKAGQSLSQTQSANEPVKPGSESPSDYAQASSYKNEVLP
PSEQRIHADKPARLTLAESGPKSSNKTQSLHRNVDTRKIQSDNKDIEDDSGNNFVAERRP
SQIVPTSLPEQRSTPAHVYSNAGGNGMQLDDEVDFLHSRGVVRRRHRRGPKQRRSNQHLE
HEAKLQRLKEELSRPVTEGHHRQSHHQKQLQHRQHHQSHHRKKHRRQQHHRRRGQSTTQY
VNHSPPGFNQSQPAQQQSVPEMDLLKAETPEDEEHLRHRVARAVTAKKERIWDYGVIPYE
IDGNFSGIHKALFKLAMRHWENSTCIKFVERDPEIHPNYIVFTVRSCGCCSFVGKRGNGP
QAISIGRNCDKFGIVVHELGHVVGFWHEHTRPDREKHVVIEHNNIMKGQDYNFNMLSPDE
VDSLGMAYDYDSIMHYARNTFSKGTYLDTILPIEMKGRKRPEIGQRLRLSQGDIAQANLL
YKCPKCGRTFQESSGIFASPSHYTAGALSNETEHCEWRITATYGERVELQLENMNIFKSN
NCETDYLEIRDGYFEKSPLIGRFCGKVDKEVIRTESSRMLLTYVNTHRNEGFRGFKAEFD
VVCGGELSVDDAVGRLESPNYPLDYLPNKECVWKITVPESYQVALKFQSFEVENHDSCVY
DYVEVRDGPGQDAPLIGVFCGYKPPPNMKSSGNSMYVKFVSDTSVQKAGFSAVFMKEVDE
CETQNHGCEHECINTLGGYECSCRIGFELHSDKKHCEDACGGVIEYPNGTITSPSFPEMY
PLLKECIWEIVAPPKHRISLNFTHFDLEGTVHQQSDCGYDSVTVYSKLGENRLKRIGTFC
GSSIPPTATSESNALRLEFHSDKSIQRSGFAAVFFTDIDECAVNNGGCQHECRNTIGSYI
CMCHNGYSMHENGHDCKEGECKYEISAPFGSIFSPNYPDSYPPNADCVWHFITTPGHRIK
LIFNEFDVESHQECSYDNVAVYDGESESSSVLGRFCGDKIPFPISSTSNQMYMVLKTDKN
KQKNGFTASHSTACGGYLRATSQVQQFYSHARFGNQDYDDGMDCEWTIAAPDNSYVQLIF
LTFDIESSENCTFDYVQVFSDIDDVYGQYGPMYGQYCGNVLPQDINSMTHSLLVRFKTDG
SVPMKGFSASYVAVPNSGEYDHSDEDVENSYSSEMVTPFPGSLKSIYIEDTQEETDEYSD
FSGNQLVFNGQYRGRYSLPNRYYSGKA
Download sequence
Identical sequences B3P6Z8
FBpp0129859 XP_001981948.1.56816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]