SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0130327 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0130327
Domain Number 1 Region: 102-116,190-434
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.64e-50
Family Nuclear receptor ligand-binding domain 0.00014
Further Details:      
 
Domain Number 2 Region: 30-118
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.76e-28
Family Nuclear receptor 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0130327   Gene: FBgn0104076   Transcript: FBtr0131835
Sequence length 438
Comment type=protein; loc=scaffold_4820:complement(1310887..1311181,1311225..1312170,1312294..1312369); ID=FBpp0130327; name=Dere\GG11781-PA; parent=FBgn0104076,FBtr0131835; dbxref=FlyBase:FBpp0130327,FlyBase_Annotation_IDs:GG11781-PA,GB_protein:EDV53016,REFSEQ:XP_001981146,FlyMine:FBpp0130327; MD5=f14351067a4ffbdbe13032c332212b78; length=438; release=r1.3; species=Dere;
Sequence
MQSSEGSPDMMDQKYNSVRLSPAASSRILYHVPCKVCRDHSSGKHYGIYACDGCAGFFKR
SIRRSRQYVCKSQKQGLCVVDKTHRNQCRACRLRKCFEVGMNKDAVQHERGPRNSTLRRH
MAMYKDAMMGAGEMPQIPAEILMNTAALTGFPGVPMPMPGLPQRAGHHPGHMAGFQPPPS
AAAVLDLSVPRVPHHPVHQGHHGFFSPTAAYMNALATRALPPTPPLMAAEHIKETAAEHL
FKNVNWIKSVRAFTELPMPDQLLLLEESWKEFFILAMAQYLMPMNFAQLLFVYESENANR
EIMGMVTREVHAFQEVLNQLCHLNIDSTEYECLRAISLFRNSILTGSGSPNSSASAESKG
LLESGKVAAMHNDARSALHNYIQRTHPAQPMRFQTLLGVVQMMHKVSSFTIEELFFRKTI
GDITIVRLISDMYSQRKI
Download sequence
Identical sequences B3P7V8
FBpp0130327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]