SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0130614 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0130614
Domain Number 1 Region: 2761-2847
Classification Level Classification E-value
Superfamily Immunoglobulin 5.87e-21
Family I set domains 0.031
Further Details:      
 
Domain Number 2 Region: 1912-1971
Classification Level Classification E-value
Superfamily BPTI-like 6.39e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0046
Further Details:      
 
Domain Number 3 Region: 2527-2609
Classification Level Classification E-value
Superfamily Immunoglobulin 1.82e-17
Family I set domains 0.01
Further Details:      
 
Domain Number 4 Region: 1840-1895
Classification Level Classification E-value
Superfamily BPTI-like 3.41e-17
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0022
Further Details:      
 
Domain Number 5 Region: 1603-1658
Classification Level Classification E-value
Superfamily BPTI-like 3.55e-17
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0016
Further Details:      
 
Domain Number 6 Region: 1781-1837
Classification Level Classification E-value
Superfamily BPTI-like 8.66e-17
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.002
Further Details:      
 
Domain Number 7 Region: 1662-1717
Classification Level Classification E-value
Superfamily BPTI-like 1.04e-16
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.003
Further Details:      
 
Domain Number 8 Region: 1997-2050
Classification Level Classification E-value
Superfamily BPTI-like 1.39e-16
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0021
Further Details:      
 
Domain Number 9 Region: 1723-1777
Classification Level Classification E-value
Superfamily BPTI-like 2.41e-16
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0027
Further Details:      
 
Domain Number 10 Region: 2311-2370
Classification Level Classification E-value
Superfamily BPTI-like 4.82e-16
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0037
Further Details:      
 
Domain Number 11 Region: 2187-2242
Classification Level Classification E-value
Superfamily BPTI-like 8.23e-16
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0052
Further Details:      
 
Domain Number 12 Region: 2122-2177
Classification Level Classification E-value
Superfamily BPTI-like 0.0000000000000014
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0058
Further Details:      
 
Domain Number 13 Region: 2066-2119
Classification Level Classification E-value
Superfamily BPTI-like 0.00000000000000255
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0046
Further Details:      
 
Domain Number 14 Region: 2248-2301
Classification Level Classification E-value
Superfamily BPTI-like 0.00000000000000298
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0039
Further Details:      
 
Domain Number 15 Region: 2623-2702
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000297
Family I set domains 0.01
Further Details:      
 
Domain Number 16 Region: 338-396
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000732
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Domain Number 17 Region: 460-520
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000034
Family TSP-1 type 1 repeat 0.0049
Further Details:      
 
Domain Number 18 Region: 2448-2494
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000523
Family Elafin-like 0.0018
Further Details:      
 
Domain Number 19 Region: 638-681
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000863
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Domain Number 20 Region: 58-110
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000942
Family TSP-1 type 1 repeat 0.0016
Further Details:      
 
Domain Number 21 Region: 579-633
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000196
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 22 Region: 524-576
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000144
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 
Domain Number 23 Region: 399-457
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000017
Family TSP-1 type 1 repeat 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0130614   Gene: FBgn0104360   Transcript: FBtr0132122
Sequence length 2895
Comment type=protein; loc=scaffold_4820:join(3669981..3670003,3678373..3678433,3678494..3678672,3678832..3679860,3679922..3680225,3680281..3683851,3683915..3684094,3684368..3684538,3684651..3685690,3685754..3685937,3685996..3686190,3686273..3686443,3686712..3687277,3687342..3687492,3687753..3688169,3688284..3688442,3688507..3688623,3688682..3688851); ID=FBpp0130614; name=Dere\GG12068-PA; parent=FBgn0104360,FBtr0132122; dbxref=FlyBase:FBpp0130614,FlyBase_Annotation_IDs:GG12068-PA,GB_protein:EDV53326,REFSEQ:XP_001981456,FlyMine:FBpp0130614; MD5=471554acf02211ef8f988b2fe9229aab; length=2895; release=r1.3; species=Dere;
Sequence
MDLSRRLCSTALVAFIVLAGIHDSHSRFPGLRQKRQYGANMYLPESSVTPGGEGSDPDEW
TPWSSPSDCSRTCGGGVSYQTRECLRRDRRGEAVCSGGSRRYFSCNTQDCPEEESDFRAH
QCSRFDRQQFDGVFYEWVPYTNAPNPCELNCMPKGERFYYRQREKVVDGTRCNDKDLDVC
VNGECMPVGCDMMLGSDAKEDKCRKCGGDGSTCKTIRNTITTKDLAPGYNDLLLLPEGAT
NIRIEETVPSSNYLACRNHSGHYYLNGDWRIDFPRPMFFANSWWNYQRKPMGFAAPDQLT
CSGPISESLFIVMLVQEKNISLDYEYSIPESLSHSQQDTHTWTHHQFNACSASCGGGTQS
RKVTCNNRITLAEVNPSLCDEKSKPVEEQACGTEPCAPHWVEGEWSKCSKGCGSDGFQNR
SITCERISSSGDHTVEEDAVCLKEVGNKPATKQECNRDVKNCPKYHLGPWTPCDKLCGDG
NQTRKVTCFIEENGHKRVLPEEDCVEEKPETEKSCLLTPCEGVDWIISQWSGCNACGQNT
ETRTAICGNKEGKVYPDKFCEPEVPTLSRPCKSPKCEAQWFSSEWSKCSAPCGKGVKSRI
VICGEFDGKTVTPADDDSSCNKETKPESEQECEGEEKVCPGEWFTGPWGECSKPCGGGER
VREVLCLSNGTKSVNCDEEKVEPLSEKCNAEACTEDEILPLTSTDKPIEDDEEDCDEDGI
ELISDKLSDDEKSEDVIDLEGTPSTEITPEAEELMQSDSPTPYDESQSTSTTLEGSGYDS
ESTTDSGISTEGSGDGEETTDLSSSTDSDSTSSDSTSSESSSSISSDATSEAPASSVSDS
SDSTDSSTETTGVSDDSTDVSSSTDASASESTDVSNASDSTESTNASDSTPEGSTEASSS
TDDSTASSDSSSNVSESSTEASSSSVSDSSDSTVGSTDGVSSTTENSSDSTSDATSDSTA
SSDSTDSTDTTSDQTTETTPESSTDSTESSTLDASSTTDATSSSESSSDSSTDGASSTSS
SEATETTGLSSDGSTTDATTIASDSTDDTTDGATDESTDGSSDASTDGSTEGASEDTTLS
TDSSGSTESTEANASDGSTTEGSTVEDLSSSTSSDATSDSTSTDSSASTDVSGSTDTSSS
TDGSSTDVSSTEASSTDASESTDSTVSGGTSDTTESGPTEESTTEGSTESTSEVSTDSTQ
STDLDSTTSDIWSTSDQDDNAESSTPYSFASEVTKSKPRKCKPKKSTCAKSKYGCCPDGK
STPKGPFDEGCPIAKTCADTKYGCCLDGVSPATGKNNKGCPKSQCAETLFGCCPDKFTAA
DGENNEGCPEITTIPPTITTEETTTVIEGSGQDTTTPEPESQMSCSFSEFGCCPDAETSA
KGPDFEGCGLASPVAKGCGESENGCCPDGQTPASGPNGEGCSGCTRERFGCCPDSQTPAH
GPNKEGCCLDTHFGCCPDNILAARGPNNEGCECHYTPYGCCPDNKSPATGYNQEGCACET
TQHGCCPDKITAAKGPKNEGCPCETTQFGCCPDGLTFAKGPHHHGCHCTQTEFKCCDDEK
TPAKGPNGEGCTCVESKFGCCPDGVTKATDEKFGGCENVPEPPQKACSLPKETGTCSNYS
VKYYFDTSYGGCARFWYGGCDGNDNRFESEAECRDTCQEYTGKHVCLLPKSAGPCDGFTK
KWYFDADRNRCEEFQYGGCYGTNNRFNTLEQCQGTCAASENLPTCEQPVESGPCGGNFDR
WYYDNETDICRPFTYGGCKGNKNNYPTEHACNYNCRQPGVLKDRCALPKQTGDCSEKLAK
WHFSENEKRCVPFYYTGCGGNKNNFPTLESCEDHCPRQVAKDICEIPAEVGECANYVSNW
YYDTKDQACRQFYYGGCGGNENRFPTEESCLARCDRKPEPTTTTTTSAPRQQPSRQDVCD
EEPAPGECSEWVLKWHFDRKTGACRQFYYGNCGGNGNRFETENDCQQRCLSQAPPAPIPT
RAPAPTRQPDPIRSVAQCSQPAEPGRCDQWVLQWNYNEAEGRCQQFYYGGCGGNDNRFAT
EDECSTRCSPNIDNRIGVDPAERDTSKCFLAYESGNCYDNVTRWFYNSEQGLCDEFVYTG
CGGNENNYATEEECQNECNEAQTTCALPPVRGRCSDLSQRWYYDERSGECHTFEFTGCRG
NRNNFRYQSECLSFCRGQPAVESEAPVYSVCAEPPEAGECENRTTAWFYDSENMACTAFT
YTGCGGNGNRFETQDQCERQCGEFKGVDVCNEPVTTGPCTNWQTKYYFDIGSQACKPFTY
GGCDGTGNRFSDLFECQTVCLAGREPRVGSAKEICMLPVATGRCNGPSIHERRWYYDDAV
GNCMSFIYAGCSGNQNNFRSFEACTNQCRPEPNKQDNEIGQNPCDTFDAECQELRCPYGV
RRVAARSQPECTQCICENPCEGYNCPEGQQCAIDVASSDDRQFAPVCRDIYKPGECPALS
ANASECARECYTDADCRGDNKCCSDGCGQLCVHPARPTQPPRTQAPVVSYPGDVITALEP
KEAQELDVQASIGGIAVLRCFATGNPAPNITWSHKNLVINTNKGRYVLTANGDLTIVQVR
QTDDGTYVCVASNGLGEPVRREVALQVTEAVSQPAYIYGDKNVTQIVQLNRPAVIRCPAG
GFPAPHVSWWRNGQMFGLKNNLMARDYSLVFNSIQLSDLGLYTCEVYNQRRPVSLRVTLK
AVGPVLPLNAGEEQYMQYVLNPATRPVTQRPSYPYRPTRPAYVPEPTVNVHAVLALEPKN
SYTPGSTIVMSCSVQGYPEPNVTWTKDDVTLYNNERVQITHQPHRLVLSDVTPADSGRYT
CRASNAYTYANGEANVSIQSVVPVSPECVDNPYFANCKLIVKGRYCSNQYYTKFCCRSCT
LAGQVAAPPLHPNAV
Download sequence
Identical sequences B3P5S6
XP_001981456.1.56816 FBpp0130614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]