SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0131205 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0131205
Domain Number 1 Region: 238-497
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.97e-66
Family Nuclear receptor ligand-binding domain 0.000000000224
Further Details:      
 
Domain Number 2 Region: 101-181
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.55e-29
Family Nuclear receptor 0.0000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0131205   Gene: FBgn0104947   Transcript: FBtr0132713
Sequence length 507
Comment type=protein; loc=scaffold_4644:complement(1905848..1907371); ID=FBpp0131205; name=Dere\GG12659-PA; parent=FBgn0104947,FBtr0132713; dbxref=FlyBase:FBpp0131205,FlyBase_Annotation_IDs:GG12659-PA,GB_protein:EDV45552,REFSEQ:XP_001982583,FlyMine:FBpp0131205; MD5=e0831b266131f38f047bfbc2123ccbd9; length=507; release=r1.3; species=Dere;
Sequence
MDNCDQDASFRLSHIKEEVKPDISQLNDSNNSSFSPKAESPVPFMQAMSMVHVLPGSNSA
SSNNNSAGDAQMAQAPNSAAGAASAVQQQYPPNHPLSGSKHLCSICGDRASGKHYGVYSC
EGCKGFFKRTVRKDLTYACRENRNCIIDKRQRNRCQYCRYQKCLTCGMKREAVQEERQRG
ARNAAGRLSASGGGSSGPGSVGGSSSGGGGGGGVSGGMGSGNGSDDFMTNSVSRDFSIER
IIEAEQRAETQCGDRALTFLRVGPYSTVQPDYKGAVSALCQVVNKQLFQMVEYARMMPHF
AQVPLDDQVILLKAAWIELLIANVAWCSIVSLDDGGAGGGGGGGLGHDGSFERRSPGLQP
QQLFLNQSFSYHRNSAIKAGVSAIFDRILSELSVKMKRLNLDRRELSCLKAIILYNPDIR
GIKNRAEIEMCREKVYACLDEHCRLEHPGDDGRFAQLLLRLPALRSISLKCQDHLFLFRI
TSDRPLEELFLEQLEAPPPPGLAMKLE
Download sequence
Identical sequences B3P8U7
XP_001982583.1.56816 FBpp0131205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]