SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0131776 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0131776
Domain Number 1 Region: 361-591
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.41e-30
Family Nuclear receptor ligand-binding domain 0.00084
Further Details:      
 
Domain Number 2 Region: 48-126
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.22e-26
Family Nuclear receptor 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0131776   Gene: FBgn0105502   Transcript: FBtr0133284
Sequence length 599
Comment type=protein; loc=scaffold_4784:complement(21141112..21142286,21142420..21142689,21143192..21143506,21143585..21143624); ID=FBpp0131776; name=Dere\GG13230-PA; parent=FBgn0105502,FBtr0133284; dbxref=FlyBase:FBpp0131776,FlyBase_Annotation_IDs:GG13230-PA,GB_protein:EDV52659,REFSEQ:XP_001973633,FlyMine:FBpp0131776; MD5=4761a7677cf9ca2be5dd2fdc12d443ad; length=599; release=r1.3; species=Dere;
Sequence
MDGVKVEAFIKSEENRAMPLIGGGSASGGTALPGGGVGMGPGASATLSVELCLVCGDRAS
GRHYGAISCEGCKGFFKRSIRKQLGYQCRGAMNCEVIKHHRNRCQFCRLQKCLASGMRTV
QHERKPIVDRKEGIIATAGGSSTSGGGGSSSTYLSGKSGYQQGRGKGHSVKAESAATPPV
HSTPATPFNLNENIFPMGLNFAELTQTLMFATQQQQQQQQQQQQSGSFSPDIPKADPEDD
EDDSMDNSSTLCLQLLANSASNNNSQHLNFNAGEAPTALPTTSTMGLIQSSLDMRVIHKG
LQILQPIQNQLERSGNLSVKPECDSEAEDSGTEDAVDAELEHMDIDFECGGNRSGGSDFV
INETVFEQDLLTDTQCAFHVQPPTLVHSYLNIHYVCETGSRIIFLTIHTLRKVPVFEQLE
AHTQVKLLRGVWPALMAIALAQCQGQLSVPTIIGQFIQSTRQLADIDKIEPLKISKMANL
TRTLHDFVQELQSLEVTDMEFGLLRLILLFNPTLLQQRKERSLRGYVRRVQLYALSSLRR
QGGIGCGEERFNVLVARLLPLSSLDAEAMEELFFANLVGQMQMDALIPFILMTSNTSGL
Download sequence
Identical sequences B3NE95
FBpp0131776 XP_001973633.1.56816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]