SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0133116 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0133116
Domain Number - Region: 393-440
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0109
Family Laminin-type module 0.032
Further Details:      
 
Domain Number - Region: 260-309
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0153
Family Laminin-type module 0.059
Further Details:      
 
Domain Number - Region: 47-75
Classification Level Classification E-value
Superfamily EGF/Laminin 0.067
Family EGF-type module 0.067
Further Details:      
 
Domain Number - Region: 350-395
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0684
Family Laminin-type module 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0133116   Gene: FBgn0106827   Transcript: FBtr0134624
Sequence length 899
Comment type=protein; loc=scaffold_4784:complement(1699342..1699598,1699716..1699748,1699837..1699983,1700045..1700350,1700419..1700916,1700980..1701186,1701674..1702713,1702890..1703101); ID=FBpp0133116; name=Dere\GG14570-PA; parent=FBgn0106827,FBtr0134624; dbxref=FlyBase:FBpp0133116,FlyBase_Annotation_IDs:GG14570-PA,GB_protein:EDV50212,REFSEQ:XP_001971186,FlyMine:FBpp0133116; MD5=d92adf8db582ef6a74a95f3f18b84cca; length=899; release=r1.3; species=Dere;
Sequence
MQCDCLNNAVCEPFSGDCECAKGYTGARCADTCPEGFFGTNCSEKCRCENGGKCHHVSGE
CQCAPGFTGPLCDMRCPDGKHGAQCQQDCPCQNDGKCQPETGACMCNPGWTGDVCANKCP
LGSYGPGCQESCECYKGAPCHHITGQCECPPGYRGERCFDECPLNTYGFNCSMTCDCAND
AVCNRANGTCMCNPGWTGAKCAERICEADKYGLDCNRTCECDMEHTDLCHPDTGKCQCSI
GWSSAQCTRPCTFLRYGPNCELTCNCKNGAKCSPVNGTCLCAPGWRGPTCEESCEPGTFG
QDCALRCDCQNGAKCEPETGQCLCTAGWKNIKCDRPCDLNHFGQDCAKVCDCHNNAACNP
QNGSCTCAAGWTGERCDRKCETGKFGHECTQKCQCDFNNSLACDATNGRCVCKQDWGGVH
CETNCRSGYYGENCDKVCRCLNNSSCDPDSGNCICSSGWTGADCAEPCPPGFYGMECKER
CPEILHGNKSCDHITGEILCRTGYIGLTCEHPCPAGLYGPACKLKCNCEHGGECNHVTGQ
CQCLPGWTGANCNESCPTDTYGQGCAQRCRCVHHKVCRKADGMCICETGWSGPRCDDVCP
EGFYGEHCMNECVCPSANFQCHASHGCVCRSGYTGDNCDELIASQRVAESETSSRASVAL
TIVLMTLFACIIFAVFFYYRRRVSNLKTEIAHVHYTHDTNPPSWPPNHNFDNPVYGMQAD
TRLLPNNMRSKMNNFDQRSTMSTEYGDDSNACGRVGSYSINYNHDLLTKNLNADLTNPIV
YNESLKEEHVYDEIKHKEGYKDPVKIYSKILFPDDEYDHLDYSRPSTSQKPHYHRMNDAM
LNINQDEEKPSNVKNMTVLLNKPLPPTEPEPQHESFDNTNTNLDNVSTASPSSSPEFRK
Download sequence
Identical sequences FBpp0133116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]