SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0133457 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0133457
Domain Number 1 Region: 198-212,244-493
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.62e-47
Family Nuclear receptor ligand-binding domain 0.000038
Further Details:      
 
Domain Number 2 Region: 125-209
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.22e-30
Family Nuclear receptor 0.0000128
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0133457   Gene: FBgn0107165   Transcript: FBtr0134965
Sequence length 497
Comment type=protein; loc=scaffold_4784:join(3183960..3183982,3184462..3185020,3185077..3185988); ID=FBpp0133457; name=Dere\GG14911-PA; parent=FBgn0107165,FBtr0134965; dbxref=FlyBase:FBpp0133457,FlyBase_Annotation_IDs:GG14911-PA,GB_protein:EDV50383,REFSEQ:XP_001971357,FlyMine:FBpp0133457; MD5=ac55a4ea3cd305d85a396348322e61ff; length=497; release=r1.3; species=Dere;
Sequence
MKFYAGEGQGPNMSDGVSILHIKQEVDTPSASCFSPSSKSTATQSGTNGLKSSPSVSPER
QLCSSTTSLSCDLHNVSLSNDGDSLKGSGTSGGNGGGGGGGTSAGNASNASAGTGSGSVR
DELRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQGNIEYTCPANNECEINKRRRKACQ
ACRFQKCLLMGMLKEGVRLDRVRGGRQKYRRNPVSNSYQTMQLLYQSNTTSLCDVKILEV
LNSYEPDALSVQTPSPQVHTTSITNDEASSSSGSIKLESSVGVTPNGTCIFQNNNNNDPN
EILSVLSDIYDKELVSVIGWAKQIPGFIDLPLNDQMKLLQVSWAEILTLQLTFRSLPFNG
KLCFATDVWMDEHLAKECGYTEFYYHCVQIAQRMERISPRREEYYLLKALLLANCDILLD
DQSSLRAFRDTILNSLNDVVYLLRHSSAVSHQQQLLLLLPSLRQADDILRRFWRGIARDE
VITMKKLFLEMLEPLAR
Download sequence
Identical sequences FBpp0133457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]