SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0133482 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0133482
Domain Number 1 Region: 813-1010
Classification Level Classification E-value
Superfamily PUA domain-like 6.96e-36
Family LON domain-like 0.0058
Further Details:      
 
Domain Number 2 Region: 692-745
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000133
Family RING finger domain, C3HC4 0.0097
Further Details:      
 
Domain Number 3 Region: 365-462
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000152
Family Tetratricopeptide repeat (TPR) 0.034
Further Details:      
 
Domain Number 4 Region: 188-242
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000114
Family RING finger domain, C3HC4 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0133482   Gene: FBgn0107190   Transcript: FBtr0134990
Sequence length 1077
Comment type=protein; loc=scaffold_4784:join(3554041..3555211,3570328..3570446,3570509..3570646,3570917..3571514,3571583..3572523,3572584..3572850); ID=FBpp0133482; name=Dere\GG14936-PA; parent=FBgn0107190,FBtr0134990; dbxref=FlyBase:FBpp0133482,FlyBase_Annotation_IDs:GG14936-PA,GB_protein:EDV50428,REFSEQ:XP_001971402,FlyMine:FBpp0133482; MD5=1bf8e0f42ee194ec37d134e59f448af1; length=1077; release=r1.3; species=Dere;
Sequence
MPLSQGYCMKPSLRAMKLLRQQEQQDQGHHMPPSSPIQCYLPHNDGQNSLHYLLAESFAK
VGSLPQAFDVYELIASSQFDGHVPLDKLNTLASALTTHIRQMGGIATPTPMPTPTPTSAG
VKSPRISDRVDMMPWSRYHHPGKQNQAEPGDFLRDVGESMDAADGSPLDLHSPTRELRVP
SPLQELEDFDPLMCPLCGDILRCPVTTNCGHTFCRQCCETITQCNICQVRFPRIQASSPV
PPVCALTTTTASGAATSLFTAPTNHNANLSLISFPVGYGVQLASSVHRLAAPPMTVTTTT
VASTTATATTTMASTSAAAALGLSAYPPAHGGGSGSNAMKFMPDVLVRRLVEKWWGPDLQ
AKKISEKASSCMHLNLLDDALKFCNASLEKAPANFKSLCLRAEVLLKLSHYQSSLADIEN
ALRTRCTSPKAHYLRALALSGLGRLEEALYNGFLAICLDKKTNLSNSEIFQHDLAKILQR
LLAQLPKNRSSLSGATPPVFQQQHRNFGTSRAPYPLLWEQVRRRRKQQHHHHHHLHHHHH
HVHLDDVEDEFGHYDNYIMAGDDMEEEVEVEVDGGEPGSLHLDGDFLFPSALDFMDHHRH
QRHVFEQKQFDLQPRRHANRKHCKRKWSVAMEPLGGKDLEEEDVDPAQAAGESQRCSRLF
AGVLDRTQQELQRLKKLDKSAPSLAMSSVAGQLIDASDFDCVVCSRTLWKPVVTPCGHTY
CLVCLDRCMDYNSPCPLCMSPLVEFNVNASASASASQHPNLNQIHLHPGSSSPVPFALGK
RPVTKFLEAAMKRFIPDHYEARFRQEIDQEPSVPVFICTAAFPAVPCPLFVCEPRYRLMV
RRAVESGDKTFGIVQPNGGKSRYYDVGTILDIRDCVQLGDGCSILSTIGCKRFKILARNE
KDGYETAKVEYICDEPIADEQVKILAGMQGVVLAKASGWFDSLSTEQKHEILQSFGQMPP
LEPNWELISDGPAWAWWIIALLPLSQQLKVDILATTSLEKRLRAIDKTLDWLHDLSHPQQ
PAHHPMNHHQQAPQSPQQAHHLDLDCEEQEAASSGSDECCLFAETGSEPHTDEELLL
Download sequence
Identical sequences FBpp0133482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]