SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0134270 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0134270
Domain Number 1 Region: 566-601,833-1036
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.62e-54
Family Nuclear receptor ligand-binding domain 0.00000523
Further Details:      
 
Domain Number 2 Region: 516-594
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.9e-25
Family Nuclear receptor 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0134270   Gene: FBgn0107968   Transcript: FBtr0135778
Sequence length 1039
Comment type=protein; loc=scaffold_4784:join(15141251..15142478,15168124..15168660,15175722..15175939,15176053..15176423,15176880..15176936,15176999..15177197,15178077..15178335,15178401..15178501,15178622..15178771); ID=FBpp0134270; name=Dere\GG15724-PA; parent=FBgn0107968,FBtr0135778; dbxref=FlyBase:FBpp0134270,FlyBase_Annotation_IDs:GG15724-PA,GB_protein:EDV51835,REFSEQ:XP_001972809,FlyMine:FBpp0134270; MD5=44953e3d566cbe92a6eaf5672001938d; length=1039; release=r1.3; species=Dere;
Sequence
MDTFNVPMLAESSNTNYPTEATSNHHHLQHQHQQQQHQHQQQHSHQQQQLLMPHHHKDQM
LAAGSSPMLTFYSHLQLQHKDATATIGPAAAAAVEAATTSANADNFSSLQTIDGSQLDGS
ISLSGLCDRFFVASPNPHSNSNMTLMGTATAPTTTTTTNNNNNNNSNNNNNNTTNNNNNN
VEAKAVRPSNGGSVIIESVTMPSFANILFPTHRSPNECIDPALLQKNPENNGPNNSSIIV
PTVEYHQLKTLEVNSSTSVSTSNFLSSTTAQLLDFEVQVGKDDSHISTTTTTTGTVAGSG
SGSGSGSGSGASTIAIATPTTTTSMNSTANPTRSSLHSIEELAASSCAPRAASPSSNHTS
SASNTPQQHPQQQQQAHHMQSGNHSGSNLSSDDESMSEDEFGLEIDDNGGYQDTTSSHSQ
QSGGGGGGGGGNLLNGSSGGSSAGGGYMLLPQAASSSGNNANPNAGHMSSGSVGNGGGGG
GNNGGAGGNSGPGNPMGGTSATPGHGGEVIDFKHLFEELCPVCGDKVSGYHYGLLTCESC
KGFFKRTVQNKKVYTCVAERSCHIDKTQRKRCPYCRFQKCLEVGMKLEAVRADRMRGGRN
KFGPMYKRDRARKLQVMRQRQLALQALRNSMGPDIKPTPISPGYQQAYPNMNIKQEIQIP
QVSSLTQSPDSSPSPIAIALGQVNASTGGVIATPMNAGTGGSGGGGLNGPSSVGNGNSSN
GSSNGNNNSSTGNGASGGGGGNNAGGGGGGTNSTDGLHRNGGNGNSSCHEAGIGSLQNTA
DSKLCFDSGTHPSSTADALIEPLRVSPMIRDFVQSIDDREWQTQLFALLQKQTYNQVEVD
LFELMCKVLDQNLFSQVDWARNTVFFKDLKVDDQMKLLQHSWSDMLVLDHLHHRIHNGLP
DETQLNNGQVFNLMSLGLLGVPQLGDYFNELQNKLQDLKFDMGDYVCMKFLILLNPSVRG
IVNRKTVSEGHDNVQAALLDYTLTCYPSVNDKFRGLVNILPEIHAMAARGEDHLYTKHCA
GSAPTQTLLMEMLHAKRKG
Download sequence
Identical sequences B3NHP0
FBpp0134270 XP_001972809.1.56816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]