SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0134433 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0134433
Domain Number 1 Region: 87-440
Classification Level Classification E-value
Superfamily L domain-like 1.53e-50
Family Ngr ectodomain-like 0.012
Further Details:      
 
Domain Number 2 Region: 371-697
Classification Level Classification E-value
Superfamily L domain-like 1.63e-49
Family Ngr ectodomain-like 0.016
Further Details:      
 
Domain Number 3 Region: 1071-1214
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.88e-42
Family Toll/Interleukin receptor TIR domain 0.0000719
Further Details:      
 
Domain Number 4 Region: 811-950
Classification Level Classification E-value
Superfamily L domain-like 6.8e-31
Family Ngr ectodomain-like 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0134433   Gene: FBgn0084171   Transcript: FBtr0135941
Sequence length 1353
Comment type=protein; loc=scaffold_4784:17490355..17494416; ID=FBpp0134433; name=Dere\GG15887-PA; parent=FBgn0084171,FBtr0135941; dbxref=FlyBase:FBpp0134433,FlyBase_Annotation_IDs:GG15887-PA,GB_protein:EDV52092,REFSEQ:XP_001973066,FlyMine:FBpp0134433; MD5=be71370a18e401a6606331fb55c611ca; length=1353; release=r1.3; species=Dere;
Sequence
MLATTHMLYVLIATWVIPIFGAALSKTVLYQAPDECRWSGGGEHDITLVCHLRTINSELE
NTNFSVIQPQNTVRLRLECNDALFFQSSLSPDSFRSLVELRDLTIEYCKLGNLTDGSFRG
LQELRNLTIRTHNGDWSTMSLEMASNSFVEFRQLERLDLSLNNIWLIPDGMVCPLKSLQH
LNASYNKIQDISNFYFSASLSSRKARVCGSTLQSLDLSANKMVSLPTAMLSALGRLTHLN
MAKNSMSFLADRAFEGLLSLRVVDLSANRLTSLPPELFAETKQLQEIYLRNNSINVLAPG
IFGELAELLVLDLASNELNSQWINAATFVGLKRLMMLDLSANKISRLEAHIFRPLASLQI
LKLEDNYIDQLPGGIFADLTNLHTLILSRNRISVIEQRTLQGLKNLLVLSLDFNRISRMD
QRSLVNCSQLQDLHLNDNKLQAVPEALAHVPLLKTLDVGENMISQIENTSITQLENLYGL
RMTENSLTHIRRGVFDRMSSLQILNLSQNKLKSIEAGSLQRNGQLQAIRLDGNQLKSIAG
LFTELPNLVWLNISGNRLEKFDYSHIPIGLQWLDVRANRITQLGNYFEIESELSLSNFDA
SYNLLTEITASSIPNSVEVLYLNDNQISKIQPYTFFKKPNLTRVDLVRNRLTTLEPNALR
LSPIAEDRDIPEFYIGHNAYECDCNLDWLQKVNRESRTQPQLMDLDQIHCRLAYARGSSH
VSLIEAKSDDFLCKYASHCFALCHCCDFQACDCKMECPDRCSCYHDQSWTSNVVDCSRAS
YEQTLPSHIPMDSTQLYLDGNNFRELQSHAFIGRKRLKVLHLNHSRIEVLHNRTFYGLLE
LEVLQLQSNQLKALNGNEFQGLDNLQELYLQHNAIATIDTLTFTHLYHLKILRLDHNAIT
SFAVWNFLPSYLNELRLASNPWSCSCEFIDKLRDYMNRHEYAVDKLKMKCDVISGNSTQQ
MVIYPASAEATSLPVVQCSQTLPLGLDNSFNYAEQAGGENASNATSTKMILNQPPKLDYI
PILVAILTVFIFVMICISLVFIFRQEMRVWCHSRFGIRLFYNAQKDVDKNEREKLFDAFV
SYSSKDELFVNEELAPMLEMGEHRYKLCLHQRDFPVGGYLPETIVQAIDSSRRTIMVVSE
NFIKSEWCRFEFKSAHQSVLRDRRRRLIVIVLGEVPQKELDPDLRLYLKTNTYLQWGDKL
FWQKLRFALPDVSSSQRATAAGQSCHVPINHAAYHHHHHVHQQAMPLPHSVHHHQQQFML
PPPPQQPGSFRRQPSLHQQQQQQQQQQQQQQQLRGNNNTTQQQQQQQAALLMGGGSVGGP
APQMIPLAGGIQQQSLPLPPNQQPTPASRNLHM
Download sequence
Identical sequences B3NI06
FBpp0134433 XP_001973066.1.56816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]