SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0134714 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0134714
Domain Number 1 Region: 408-434,618-856
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.82e-64
Family Nuclear receptor ligand-binding domain 0.0000498
Further Details:      
 
Domain Number 2 Region: 355-438
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.03e-30
Family Nuclear receptor 0.0000519
Further Details:      
 
Domain Number 3 Region: 468-524
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.000000811
Family beta-sandwich domain of Sec23/24 0.027
Further Details:      
 
Weak hits

Sequence:  FBpp0134714
Domain Number - Region: 299-346
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00366
Family beta-sandwich domain of Sec23/24 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0134714   Gene: FBgn0108403   Transcript: FBtr0136222
Sequence length 863
Comment type=protein; loc=scaffold_4784:join(20904624..20905518,20908038..20908279,20908335..20908476,20932502..20933160,20933240..20933515,20933574..20933951); ID=FBpp0134714; name=Dere\GG16168-PA; parent=FBgn0108403,FBtr0136222; dbxref=FlyBase:FBpp0134714,FlyBase_Annotation_IDs:GG16168-PA,GB_protein:EDV52619,REFSEQ:XP_001973593,FlyMine:FBpp0134714; MD5=a251d67bd0439eedf06fc112a9cbaabd; length=863; release=r1.3; species=Dere;
Sequence
MDVYQIELEAQAQIRSNLLVETCVKHSSSEQQQLQVKQEDLIKDFARDAEEQPSEEEAEE
EDEEEDEEEEDEEEDEEALLPVVNFNANSDFNLHFFDTPEDSSTQGAYSEANSLESEQEE
EEQTHQPPQQQQQQHHRELEDCLSAIEADPLQLLHCDDFYRTAAPAESVAASLGPQQQQQ
QHTHQQQQQQQHPGQQQHQLNCTLSNGGGALYTISSVHQFGPASNHNTSSSSPSSSGAHS
SPDSGCSSASSSGSSGSCGSSSASSSSSAVSSSNGSSRSNNSVVNPAATSSSVAHLNKEQ
QQQSLATTQLQQQQQQQQHQQQLQHPQQQQQSFGLADSSSNNGSGNNNGVSSKSFVPCKV
CGDKASGYHYGVTSCEGCKGFFRRSIQKQIEYRCLRDGKCLVIRLNRNRCQYCRFKKCLS
AGMSRDSVRYGRVPKRSRELNGAAASSAAAGAPASLNVDDTTSSTLHPSHLQQQHQQHLL
QQQQQQQQQQQQQQQQQHQQLQQQPQPHVSGARVKTPSTPQTPQMCSIASSPSELGGCNS
ANNNNNNSNNSSGGNASGGSGVSVGVVVVGGHQQLVGGSMVGMAGMGTDAHQVGGMCHDG
LAGTANELTVYDVIMCVSQAHRLNCSYTEELTRELMRRPVTVPQNGIASTVAESLEFQKI
WLWQQFSARVTPGVQRIVEFAKRVPGFCDFTQDDQLILIKLGFFEVWLTHVARLINEATL
TLDDGAYLTRQQLEILYDSDFVNALLNFANTLNAYGLSDTEIGLFSAMVLLASDRAGLSE
PKVIGRARELVAEALRVQILRSRTGSPQALQLMPALEAKVPELRSLGAKHFSHLDWLRMN
WTKLRLPPLFAEIFDIPKADDEL
Download sequence
Identical sequences B3NIX3
XP_001973593.1.56816 FBpp0134714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]