SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0135359 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0135359
Domain Number 1 Region: 335-622
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.79e-44
Family Eukaryotic proteases 0.0012
Further Details:      
 
Domain Number 2 Region: 161-203
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000432
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 3 Region: 23-63
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000131
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 4 Region: 68-105
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000969
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 5 Region: 244-288
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000264
Family Complement control module/SCR domain 0.0031
Further Details:      
 
Domain Number 6 Region: 122-153
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000196
Family LDL receptor-like module 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0135359   Gene: FBgn0109043   Transcript: FBtr0136867
Sequence length 629
Comment type=protein; loc=scaffold_4770:join(9150290..9150356,9151023..9151326,9151437..9151921,9151989..9152292,9152345..9152566,9152634..9153141); ID=FBpp0135359; name=Dere\GG16813-PA; parent=FBgn0109043,FBtr0136867; dbxref=FlyBase:FBpp0135359,FlyBase_Annotation_IDs:GG16813-PA,GB_protein:EDV48793,REFSEQ:XP_001979835,FlyMine:FBpp0135359; MD5=0b489ed7c085363656b3274415129fec; length=629; release=r1.3; species=Dere;
Sequence
MQLKSILTNPLFFCAVLLRFKTISTACDSSQFECDNGSCISQYDVCNGERNCPDGSDETA
LTCVSQRQHCTKPYFQCTYGACVIGTAGCNGVSECADGSDETRLRCGNEDDIRQHDRRLQ
GNCQDNEFKCPSGICLDKSKFLCDGKDDCADGTGFDESVELCGHMECPAYSFKCGTGGCI
SGSLSCNGENDCYDGSDEAPLLCNTTRKVVSTTVAIETALELLGCPLPLGDERPILTGDG
NRVLTGPITRGTVRFSCKQGHVLEGEESSYCAKKKWSTSTIPKCVKYCSTAGEFDGYSTK
ALCTHNGQQVDCRKPFHPPGTEVKFVCATGFKSLSTLPEMRCMKGGYWNRGRQRCEQDCG
QLATPIKSFSFGGYTINNTVVPWHVGLYVWHNEKDYHFQCGGSLLTPDLVITAAHCVYDE
GTRLPYSYDTFRVIAAKFYRNYDEITPDEKRRDVRLIEIAPGYKGRTENYYQDLALMTLD
EPFELSHVIRPICVTFASFAEKESVTDEVQGKFAGWSIENKHELQFVPAVSKSNSVCRAN
LRDIQADKFCIFTQGKSLACQGDSGGGFTSELQTKAFSAWNTARHFLFGVISNAPNADQC
AHSLTVMTNIQHFEDMILNAMNRSVETRS
Download sequence
Identical sequences B3NZC1
FBpp0135359 XP_001979835.1.56816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]