SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0136055 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0136055
Domain Number 1 Region: 98-397
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 3.65e-29
Family NodB-like polysaccharide deacetylase 0.015
Further Details:      
 
Domain Number 2 Region: 28-89
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 7.32e-16
Family Tachycitin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0136055   Gene: FBgn0109734   Transcript: FBtr0137563
Sequence length 486
Comment type=protein; loc=scaffold_4690:complement(18335104..18335431,18338764..18339149,18340889..18341108,18354972..18355114,18360108..18360235,18366631..18366742,18366832..18366923,18373346..18373397); ID=FBpp0136055; name=Dere\GG17509-PA; parent=FBgn0109734,FBtr0137563; dbxref=FlyBase:FBpp0136055,FlyBase_Annotation_IDs:GG17509-PA,GB_protein:EDV47665,REFSEQ:XP_001978738,FlyMine:FBpp0136055; MD5=5e1f5ffea6bef5d23704697dff6772af; length=486; release=r1.3; species=Dere;
Sequence
MLRQCLVAVLLVVAGANGQGKEKEEFQCPSHIANGNYADPATCRRFYQCVDGYPYLNRCP
SGLFFDDVQKFCTFKDEAKCGPLPTTPAPATEAPADTAQRCNTENCALPYCFCSKDGTQI
PGDLEPEKVPQIIMLTFDGAVNLNNYQHYQKIFDGKRKNPNGCLIRGTFFMSHEYSNYQQ
IQHLGYYGHEIGTESISQQQGLQDKGYEEWVGEMIGMREILRHFANVSVNDVVGMRAPFL
KPGRNTQYKVLEDFGYIYDSSITVPPVPVPVWPYTLDYKISHECKSGTCPSRTFPGVWEV
PLNTHYVEGYEGGHCPYLDQCVLHNLDEEEVFQWLQEDFLRYYEQNKAPYMMPFHTNWFQ
TKPLENGLHKFLDWALDQPDVYMLTVTQMLQYMTDPKELRDVSQIESWKCDKSVSVAPKP
CNIWQTCALPFKIPEQNLTDTRYMETCRECPNVYPWLGDAGGTGIAGRDNYIYAGGDNPE
EEESAK
Download sequence
Identical sequences B3NY80
XP_001978738.1.56816 FBpp0136055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]