SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0140549 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0140549
Domain Number 1 Region: 414-742
Classification Level Classification E-value
Superfamily L domain-like 2.21e-49
Family Ngr ectodomain-like 0.058
Further Details:      
 
Domain Number 2 Region: 110-455
Classification Level Classification E-value
Superfamily L domain-like 4.49e-47
Family Ngr ectodomain-like 0.0081
Further Details:      
 
Domain Number 3 Region: 831-997
Classification Level Classification E-value
Superfamily L domain-like 2.04e-27
Family Ngr ectodomain-like 0.026
Further Details:      
 
Domain Number 4 Region: 1094-1234
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.49e-22
Family Toll/Interleukin receptor TIR domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0140549   Gene: FBgn0084217   Transcript: FBtr0142057
Sequence length 1449
Comment type=protein; loc=scaffold_4845:9876490..9880839; ID=FBpp0140549; name=Dere\GG22003-PA; parent=FBgn0084217,FBtr0142057; dbxref=FlyBase:FBpp0140549,FlyBase_Annotation_IDs:GG22003-PA,GB_protein:EDV55258,REFSEQ:XP_001974858,FlyMine:FBpp0140549; MD5=79564b679643014ec8d4753fe0e56efc; length=1449; release=r1.3; species=Dere;
Sequence
MAAILLLLLGFSWSLAAESALAPKESESSVSAMLGAGTGAAATVSLSGDYSSLLSNVPAA
SPVPANPSQHSGPANQCSWSYNGTSSVHCALRLIERQPGLDLQGADGSSQLTIQCSELYL
FESSLPVAVFARLQTLEALRLDSCKLLQLPNNAFEGLATLKSLRLSTHNSEWGPTRTLEL
FPDSLGGLKQLTDLDLGDNNLRQLPSGFLCPVGNLQVLNLTRNRIRTAEQLGFADMNCGA
GSGSAGSELQILDASHNELRSISESWGISRLRRLQHLNLAYNNLSELSGEALAGLASLRI
VNLSNNHLETLPEGLFAGSKELREIHLQQNELYELPKGLFHRLEQLLVVDLSGNQLTSNH
VDNTTFAGLIRLIVLNLAHNALTRIDYRTFKELYFLQILNLRNNSIGHIEDNAFLPLYNL
HTLNLAENRLHTLDDKLFNGLYVLSKLTLNNNLISVVEPAVFKNCSDLKELDLSSNQLNE
VPRALQDLAMLRTLDLGENQIRTFDNQSFKNLHQLTGLRLIDNQIGNITVGMFQDLPRLS
VLNLAKNRIQSIERGSFDKNFELEAIRLDRNFLADINGVFATLVSLLWLNLSENHLVWFD
YAFIPSNLKWLDIHGNYIEALGNYYKLQEEIRVKTLDASHNRITEIGPMSIPNTIELLFI
NNNLIGNVQPNAFVDKANLARVDLYANQLSKLQLQQLRVAPVVAPKPLPEFYLGGNPFEC
DCTMDWLQRINNLTTRQHPRVMDMANIECVMPHARGAAVRPLSGLRPQDFLCRYESHCFA
LCHCCDFDACDCEMTCPSNCTCYHDQIWSTNVVDCGGQQTTELPRRVPMDSSVVYLDGNN
FPVLKNHAFIGRKNLRALYVNGSQVAGIQNRTFASLASLQLLHLADNKLRTLHGYEFEQL
SALRELYLQNNQLTTIENATLAPLAALELIRIDGNRLVTLPIWQMHATHFGTRLKSISLG
RNQWSCRCQFLQALTSYVADNALIVQDAQDIYCMAASSGSGSAALEDSSSNSASLEKREL
DFNATGAACTDYYSGGSMLQHGIPESYIPLLAAALALLFLLVVIAMVFAFRESLRIWLFA
HYGVRVFGPRCEESEKLYDAVLLHSAKDSEFVCQHLAAQLETGRPPLRVCLQHRDLAHDA
THYQLLEATRVSRRVVILLTRNFLQTEWARCELRRSVHDALRGRPQKLVIIEEPEVAFEA
ESDIELLPYLKTSAVHRIRRSDRHFWEKLRYALPVDYPTFRGNNYTLELDHHNHERVKQP
ASPGLLYRQAPPPAYCGPADGVGIAAVPQVVPVNASVPAEQNYSTATTATPSPRPQRRGE
QPGSGSGGNHHLHAQYYQHHGMRPPSEHIYSSIDSDYSTLDNEQHMLMMPGAPGGLAMEA
AQRAQTWRPKREQLHLQQAQAGTLGSKASQSAHQQQQQQQQQQQQQQQPQNPTAVSGQQQ
GPHVQAYLV
Download sequence
Identical sequences B3NJH1
XP_001974858.1.56816 FBpp0140549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]