SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0141312 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0141312
Domain Number 1 Region: 213-514
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 5e-38
Family NodB-like polysaccharide deacetylase 0.014
Further Details:      
 
Domain Number 2 Region: 107-156
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000023
Family Tachycitin 0.027
Further Details:      
 
Domain Number 3 Region: 168-201
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000694
Family LDL receptor-like module 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0141312   Gene: FBgn0114931   Transcript: FBtr0142820
Sequence length 576
Comment type=protein; loc=scaffold_4845:join(19810577..19810772,19812135..19812867,19812930..19813452,19813511..19813789); ID=FBpp0141312; name=Dere\GG22766-PA; parent=FBgn0114931,FBtr0142820; dbxref=FlyBase:FBpp0141312,FlyBase_Annotation_IDs:GG22766-PA,GB_protein:EDV56652,REFSEQ:XP_001976252,FlyMine:FBpp0141312; MD5=40f5d6c9830a32bfa0be09ce15b7abf1; length=576; release=r1.3; species=Dere;
Sequence
MLCPGENGHNVNCQTGFTVKVVASAQRRWKPPSARSPHAHRLPSLSILMVVAIMIMSSSL
DALVIDNDGIISNQTRHRRSTSGAASCMQDARFYRNPNRPVHKIWTNSECAKYFLCLDGE
VFEFKCSEGLLFDVVRQICDFKANVDNCDVSAETPAPKPLLEMADCADEYQLGCADGTCL
PQEYFCDGSVDCPDGSDEGWCDVEHDPNAAGACDPRKCQLPQCFCSKDGTQIPGSLTAHS
VPQMILLTFDDAINHDNWELFSKVLFTQNRRNPNGCPIKGTFYVSHPFTNYQYVQKLWND
GHEIAVHSVTHRGPEMWWSKNATIEDWFDEMVGQANIINKFAAVRMEEIRGMRVPFLRVG
WNRQFLMMKEFGFVYDSSMVAPHSNPPLWPYTLDYKMPHSCTGVNQNCPSRSYPGIWELV
MNQLEAGEYMCGMVDSCPPHLSGEDVYRMLTHNFKRHYLSNRAPFGLYFHSTWFKKVDYL
NAFLKFLDDLQKLPDVFFVTNQQAIQWMRHPTPTNQLHQFESWHCQPKDLDPHEQVCNSP
NVCKVRSRVLQEDRFFYTCMDCPAQYPWIRNEFGLD
Download sequence
Identical sequences B3NNK1
XP_001976252.1.56816 FBpp0141312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]