SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0141323 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0141323
Domain Number 1 Region: 581-772,860-1016
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.35e-88
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000018
Further Details:      
 
Domain Number 2 Region: 464-565
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.28e-20
Family Anticodon-binding domain 0.0016
Further Details:      
 
Domain Number 3 Region: 293-389
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.43e-16
Family Anticodon-binding domain 0.0026
Further Details:      
 
Domain Number 4 Region: 149-243
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000441
Family Anticodon-binding domain 0.0041
Further Details:      
 
Domain Number 5 Region: 751-870
Classification Level Classification E-value
Superfamily GAD domain-like 0.00000000283
Family GAD domain 0.015
Further Details:      
 
Weak hits

Sequence:  FBpp0141323
Domain Number - Region: 60-97
Classification Level Classification E-value
Superfamily Porins 0.0977
Family Ligand-gated protein channel 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0141323   Gene: FBgn0114942   Transcript: FBtr0142831
Sequence length 1145
Comment type=protein; loc=scaffold_4845:join(19897948..19898115,19898195..19898366,19898527..19899030,19899096..19899274,19899336..19899425,19899482..19900939,19901003..19901869); ID=FBpp0141323; name=Dere\GG22777-PA; parent=FBgn0114942,FBtr0142831; dbxref=FlyBase:FBpp0141323,FlyBase_Annotation_IDs:GG22777-PA,GB_protein:EDV56668,REFSEQ:XP_001976268,FlyMine:FBpp0141323; MD5=a67c9142850ecaad9d8a7bb037568504; length=1145; release=r1.3; species=Dere;
Sequence
MLLISRTLWRSHQRLQLQQQLVHSASSGGFLAERHIRHRSTPDSLVSAQEPADCGHIMSG
RYRGGGGGGGGGGRFGGRGGGGYADSGGYNDFDNYRGGGGPGFGPGPGPSHFNMGGPNIS
GNELMQLMSAMAASNFNMTSQPPQPMRQSCGELRNHHCGLFVELSGRLIKKRVNRFAELR
DRNGGACQLVVLEDKHPRVARRMNNMPENTTLTIVGLVMRRPHNSCNQTMPTGEIEVEVQ
DILNIHFPASGTKRASDKRTYSTMVQQQSNLGITSTEYKIAKNENILKYFENRDLTCNDL
RRDDVGKTVTLVGWVPSTKNNKFLQLKDGYGQTQLMIEDQSLSDTFLSTPEQTVIQIVGK
VLGRPKANVNLKYDTGEVEVSVTSVKVLNPDDPYDGPVKTKEKRQKLSIDDLEAEEAAAE
ASVNLSSNNGESKEDGAEAVTTANPSVIAEQRVKVADTNKFADRTHNCGELTSNDINEKV
VICGWLEFQRMNKFFILRDAYGQTQVLLLPKTEGLEEYAETGVPIESIVRVEGTVIPRPA
ATINPKMQTGHVEVEADKVVVLNPAKKNLPFEIRKFNRAGERLRLTHRYLDLRFNDMQHN
LRLRSAVIMKMREYLINYLGFVEVETPTLFRRTPGGAQEFVVPTRKAGHFYSLVQSPQQF
KQMLMSGGIDRYFQVARCYRDEATRPDRQPEFTQLDIELSFTSRDDIMQLIEETLRYSWP
KDFPRLQTPFRRITYEEAMEKYGNDKPDTRFGFLLNNVSEIIEKSDDFKEKYEDLGAYAI
VVRASEAFWNGAARKHYESLGKEFKGTLFVRKFGPTQDVQEKLGKLLGEDVATEIADKFD
LEENDLLFLGIGPKVETRAILGRIRLDYHEFLVENAKVKKPNDFRFLWVIDFPLFERNRE
TNQLESVHHPFTLPHSDDLDNFATSCENLENIRSQAYDLVLNGQEVGGGSIRIHDRDMQH
FILEQILKIPHDHLSHLLSALESGCPPHGGIALGLDRLIAILCRARSIRDVIAFPKSLNG
RDPLSNAPVPISDEEMRLYHLSVVEEEEASTNNTSHEQEDDDPDQERAPPSPLSATSESE
QPQMDADIKREPEDQKEDFDPESVSVKPPTKAAVKADPEENPPAEPVASVAATPTRARRT
VKKKV
Download sequence
Identical sequences FBpp0141323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]