SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0142399 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0142399
Domain Number 1 Region: 633-782
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.96e-40
Family Toll/Interleukin receptor TIR domain 0.00019
Further Details:      
 
Domain Number 2 Region: 176-382,459-573
Classification Level Classification E-value
Superfamily L domain-like 4.42e-33
Family Ngr ectodomain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0142399   Gene: FBgn0115992   Transcript: FBtr0143907
Sequence length 795
Comment type=protein; loc=scaffold_4929:complement(12002194..12003535,12004595..12005640); ID=FBpp0142399; name=Dere\GG23853-PA; parent=FBgn0115992,FBtr0143907; dbxref=FlyBase:FBpp0142399,FlyBase_Annotation_IDs:GG23853-PA,GB_protein:EDV58676,REFSEQ:XP_001969617,FlyMine:FBpp0142399; MD5=76464eb373afd73b82aaf2593ad1c320; length=795; release=r1.3; species=Dere;
Sequence
MLSYLPVAWLFLALLVLRAATGQIIPLPTFCLGLSPQCTCAAEANVVRFHCPDEYAMLLE
VSEPGASLYMSYYSCTDLHWLPRFNISSLVKIEFDAYIFWPEEFLSGLLEALGVQTVKAI
IFRDRTLETVVTRDVQNSADGYMETSQPRNITTWHFGSVSGLKKFKFYSQVPMLQESIFH
GFDTLRDLQLSVNVTTLPEKMLSTVNGTLKTLTIESPGIVSFGNPLLCELQQLRNLSLAL
VAPSHARDKQLQPHFFGSMKNLEEVRLASATSSVNRTMFKGTNKLQLIKMNGNDDLTELP
GLIFLDQVNLKTLDLSCNAIGTLHEDVFKGLGNLTLLDLSKNRLTNLSSTIFAPLSSLNV
LRLNKNSLTAMSPSVFQDVVSLNYIEMVQTQFYGATLQMNYEAVVCTNDETCQYKSAEWQ
CDPRCICWVQRSIGSLIVDCRGTSLAELPDLPRTTLLSTVLKGGNNSLTSLPSVSEHRGY
ANVSGLFLSDNNLTTLGTGDQLPENLTHLDVRGNQIQSISDEFLLFLQQPKNTITLSLSG
NPISCGCESLQLLFFVRTNPQRVRDIADIVCTKQRKSFQQMEAFELCPSYVLLISCVIGG
LVIIICLITVFYLMFQQELKIWLYNNNLCLWWVSEEELDKDKTYDAFISYSHKDEELISK
LLPKLESGPHPFRLCLHDRDWLVGDCIPEQIVRTVDDSKRVIIVLSQHFIDSVWARMEFR
IAYQATLQDKRKRIIIILYRELEHMNGIDSELRAYLKLNTYLKWGDPLFWSKLYYAMPHN
RRVLKGQKKHAGPLI
Download sequence
Identical sequences B3NAW2
FBpp0142399 XP_001969617.1.56816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]