SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0143649 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0143649
Domain Number 1 Region: 83-97,483-687
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.88e-58
Family Nuclear receptor ligand-binding domain 0.0000927
Further Details:      
 
Domain Number 2 Region: 10-100
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.54e-27
Family Nuclear receptor 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0143649   Gene: FBgn0117232   Transcript: FBtr0145157
Sequence length 693
Comment type=protein; loc=scaffold_4929:join(6011349..6011358,6013388..6013471,6013529..6013690,6021476..6022818,6022915..6023397); ID=FBpp0143649; name=Dere\GG25103-PA; parent=FBgn0117232,FBtr0145157; dbxref=FlyBase:FBpp0143649,FlyBase_Annotation_IDs:GG25103-PA,GB_protein:EDV57919,REFSEQ:XP_001968860,FlyMine:FBpp0143649; MD5=230deb7e0cb7521f4ada5091c1c8ddd5; length=693; release=r1.3; species=Dere;
Sequence
MGTAGDRLLDIPCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRIYTCKATGDLKGRCP
VDKTHRNQCRACRLAKCFQSAMNKDAVQHERGPRKPKLHPQLHHHHHHAAAAAAAAHHAA
HHHHHHHHHAHAAAAHHAAVAAAAASGLHHHHHAMPVSLVTNVSASFNYTQHISTHPPAP
AAPPSGFHLTASGAQQGAVPPAGHLHHGAAGHQHATAFHHPGHGHALPAPHGGVVSNPGG
NTSAISASGAGNTLPFPSHLLHHNLIAEAASKLPGITATAVAAVVSSTSAPYVSAAQASS
TSSNNHNYSSPSPSNSIQSISSIGSRSGGGEEGLSLGSESPRVNVETETPSPSNSPPLSA
GSISPAPTLTTSSGSPQHRQMSRHSLSEATTPPSHASLMICASNNNNSSNSNNNNNNNNG
EHKQASYTSGSPTPTTPTPPPARAGVGSTCNTASSSSGFLELLLSPDKCQELIQYQVQHN
TLLFPQQLLDSRLLSWEMLQETTARLLFMAVRWVKCLMPFQTLSKNDQHLLLQESWKELF
LLNLAQWTIPLDLTPILESPLIRERVLQDEATQTEMKTIQEILCRFRQITPDGSEVGCMK
AIALFAPETAGLCDVQPVEMLQDQAQCILSDHVRLRYPRQATRFGRLLLLLPSLRTIRAA
TIEALFFKETIGNVPIARLLRDMYTMEPAQVDK
Download sequence
Identical sequences B3N589
FBpp0143649 XP_001968860.1.56816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]