SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0143771 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0143771
Domain Number 1 Region: 489-693
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 8.39e-51
Family Nuclear receptor ligand-binding domain 0.0000186
Further Details:      
 
Domain Number 2 Region: 263-348
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.18e-30
Family Nuclear receptor 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0143771   Gene: FBgn0117349   Transcript: FBtr0145279
Sequence length 702
Comment type=protein; loc=scaffold_4929:join(8258018..8258792,8280500..8280727,8280975..8281143,8281328..8281497,8281586..8281689,8281756..8281902,8281961..8282204,8282268..8282418,8282484..8282604); ID=FBpp0143771; name=Dere\GG25225-PA; parent=FBgn0117349,FBtr0145279; dbxref=FlyBase:FBpp0143771,FlyBase_Annotation_IDs:GG25225-PA,GB_protein:EDV58140,REFSEQ:XP_001969081,FlyMine:FBpp0143771; MD5=28bf025c7307c03604f27da1a5bcfa10; length=702; release=r1.3; species=Dere;
Sequence
MASLLGSAPPAQILANQPIIVKIEPTQSFHIVEEGDTRVLSLPLSDADKLGASWIDLKDI
AGLQAGGGATLLDVCFEQANEEGTIIATVQPDLENDLDGEMEADGEPEDETEPEPPAPKR
LATTRPAQSRPPQQQQQQQQQQVKFLSDPPALARSSSFSSLSSFSSISNISSVCKNMASN
TSQEGTLKRTKERTPPPMPPLTPQRPAATSTATSASASASAASAASAASAAAAATASATS
ARDNSREHSSSGSNGAMTAQIEIIPCKVCGDKSSGVHYGVITCEGCKGFFRRSQSSVVNY
QCPRNKQCVVDRVNRNRCQYCRLQKCLKLGMSRDAVKFGRMSKKQREKVEDEVRFHRAQM
RAQSDAAPDSSVYDTQTPSSSDQLHHNNYNSYSGGYSNNEVGYGSPYGYSASVTPQQTMQ
YDISADYVDSTTYEPRSTIIDPEFISHADGDINDVLIKTLAEAHANTNTKLEAVHDMFRK
QPDVSRILYYKNLGQEELWLDCAEKLTQMIQNIIEFAKLIPGFMRLSQDDQILLLKTGSF
ELAIVRMSRLLDLSQNAVLYGDVMLPQEAFYTSDSEEMRLVSRIFQTAKSIAELKLTETE
LALYQSLVLLWPERNGVRGNTEIQRLFNLSMNAIRQELETNHAPLKGDVTVLDTLLNNIP
NFRDISILHMESLSKFKLQHPNVVFPALYKELFSIDSQQDLT
Download sequence
Identical sequences FBpp0143771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]