SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gb|GLP15_4022 from Giardia lamblia 2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gb|GLP15_4022
Domain Number 1 Region: 12-238
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 2.98e-40
Family ROO N-terminal domain-like 0.00000824
Further Details:      
 
Domain Number 2 Region: 256-405
Classification Level Classification E-value
Superfamily Flavoproteins 3.83e-28
Family Flavodoxin-related 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gb|GLP15_4022
Sequence length 414
Comment | organism=Giardia_lamblia_P15 | product=A-type flavoprotein lateral transfer candidate | location=contig499:826-2070(-) | length=414
Sequence
MSSKPKYVQDQEMIPGVYWVGIVDWMVRIFHGYHTDEGSSYNSYFIDDECPTVIDSVKYP
FAEEWLSRIAACCPLDKIKYVVMNHAEGDHASSLKDHYHKFTNATFVCTKKCQEHLKILY
GMEKATWLIVDDKYTLKIGKRTLKFIPVPLLHWPDSTFTYCPEDKILFSNDGFGQHYATS
KRWADECDVSHVMHLFKEYTANILGLFSAQMRKALEVASTVEIKYILSAHGVSWRGDAMG
LAIAEYDRWSKGQHCQKKVTVVLDSMYGTTHRMALALLDGARSTGCETVLLEMTSSDITK
VALHTYDSGAVAFASPTLNNTMMPSIAAALNYVRGLTLIKGKPAFAFGAFGWSNRAVPDI
VAELRDGCKADVYDEKGITFKFNYTEELLEQAYNAGVDLGKRAIAYCEKNAPKQ
Download sequence
Identical sequences E1F374
gb|GLP15_4022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]