SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gb|GLP15_4116 from Giardia lamblia 2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gb|GLP15_4116
Domain Number 1 Region: 41-481
Classification Level Classification E-value
Superfamily SIS domain 6.16e-92
Family Phosphoglucose isomerase, PGI 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gb|GLP15_4116
Sequence length 584
Comment | organism=Giardia_lamblia_P15 | product=Glucose-6-phosphate isomerase | location=contig523:30534-32288(-) | length=584
Sequence
MQERHFRGYKLYDDRNSFALEFGGFRGFNARAQGALYKQAHAAAFDLIDKIEKLENVNVT
KHPTESENRSVDHYNLRMECEVKGRSLAKSIALWNSVKAFAKKCIDAKEYDHVIYNGIGG
SYLGPYLLLTAKYGDDFNMALRAKGMPTAHFVANTDPASFAQVIELVTEGAILSQGTKVV
DATKAAEKLERTLMVVISKSGGTAETATNCATYLTLLKDLKVPKPGYSLVAVTTEGSKLD
KQAEEQQFREVFHMNEATGGRTSVCSAVGMVPAAFAGVDFESFLIGMSEMDKLTRSHRES
PMHNPAIAYATLLDWMLKDKSAPFNLILLAYSDPLKHLSHYCQQLFMESLGKNYTREALP
LKTGLTILGGTGTGEQHAFMQQIQKGCSDAAVQMIRCRKRVADYPDAAAGSMGRQLLAFV
KGTEMALYQNERAFVCITIDGFSERCIGQLVAFEERVVTILSAFWNINAFDQPGVQDGKL
ACLVCNKLSKEIEYCLARSCSEQKICKGTAPELLKALGVATKAEVAGPYADVEHEDITAW
MADAVFEDIVANCDIPGAYPSLTGRIACSKKWEDRAFTYSFAKK
Download sequence
Identical sequences E1F6A8
gb|GLP15_4116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]