SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000000182 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000000182
Domain Number 1 Region: 30-176
Classification Level Classification E-value
Superfamily C-type lectin-like 8.22e-38
Family C-type lectin domain 0.0000956
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000000182   Gene: ENSGALG00000028659   Transcript: ENSGALT00000000183
Sequence length 188
Comment pep:known chromosome:Galgal4:16:104372:106726:-1 gene:ENSGALG00000028659 transcript:ENSGALT00000000183 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEVREYPHVLGTEWSRREGPSRGACVTFQLTMAAVFTVLLITAVAFAVQAFQPHPQPCA
QCPFDWIGFRGKCYYFSEDESNWTSSQNNCSALGASLAVFDSAEDLSFTMRHKGSSPHWV
GLSREGKEHPWEWVNRSPLSHLFQVQGDGLCAYLGDAGLSSSHCSARRNWVCTKPALQKP
RKNFCIST
Download sequence
Identical sequences A5HUL1
ENSGALP00000000182 XP_015150434.1.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]