SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000000206 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000000206
Domain Number 1 Region: 311-531
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.42e-50
Family Reprolysin-like 0.003
Further Details:      
 
Domain Number 2 Region: 1075-1131
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000112
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 3 Region: 621-673
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000222
Family TSP-1 type 1 repeat 0.002
Further Details:      
 
Domain Number 4 Region: 901-964
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000235
Family TSP-1 type 1 repeat 0.0046
Further Details:      
 
Domain Number 5 Region: 968-1024
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000314
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number 6 Region: 1026-1070
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000484
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000000206   Gene: ENSGALG00000000151   Transcript: ENSGALT00000000207
Sequence length 1195
Comment pep:known_by_projection chromosome:Galgal4:Z:45146955:45309166:-1 gene:ENSGALG00000000151 transcript:ENSGALT00000000207 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNSGRMRLSRVCCVFYQLCVLSSGLAAGLHASVDSEEWEIVFPALWSRGQQEPAGGSGG
GGGGSAEPGCGNRSSAPSAPAAPSPATGSSREVRSVSSSVEGPAQAAGEAAEEEDAEDEY
ESQEFYHWTPLPQGSGATPQLPATLSPPPPPLAEDGDEVLLRIPAFARELYLLLKRDSRF
LAPGFAVEERLGGDSRSQQGTAQGQPERACYYSGAVLRYPGSFASFSTCGGLMGFIQINE
DFIFIEPLNHTLAVTGHAHRVYRRKRSVEEKITEKATSQNRYCGVVTDKRKSKHQKVSES
GRGKRYSYKLPQEYNIETVVVADPAMVLYHGTDAARRFILTILNMVFNLFQHKSLGLQVN
LRVTKLVLLHETPADMYIGHHGEKMLESFCKWQHEEFGKKNDIHLEMSTSWGEDMSSVDA
AILITRKDFCVHKDEPCDTVGIAYLSGMCSEKRKCIIAEDNGLNLAFTIAHEMGHNMGIN
HDNDHPSCADGLHIMSGEWIKGQNLGDVSWSRCSREDLERFLRSKASNCLLQTNPQSLNS
VIIPSKLPGMTYTADEQCQIIFGPTASFCQEMQHVICTGLWCKVESEKECKTKLDPPMDG
TDCETGKWCKSGECINRTTLVEHMEGEWSMWSTCSRTCNTGISSRQRKCPGLSVEGECHG
PMMQYRICENPSCPAGVPAFRDWQCQAFSIRSSYQKHVHQWQAVIDDEKPCALFCTPSGK
DQPILLTEKVMDGTSCGQHGLDICADGRCQKFGCDGIVGSLAREDHCGVCNGNGKSCKVI
KGDFNHTRGAGYVEALVIPAGARRIKVVEEKPAHSYLALRDAGKQSINSDWKIEHSGTFN
IAGTTVHYVRRGLWEKISAKGPTTSPLHLLVLLFHDQSYGLHYEYTIPLDPPPENQSSKV
PEPLFMWTHSGWEDCDAVCGGGERKTTVSCTKIMNKNISLVDNKKCKYLTKPEPQIRKCN
EQPCQTRWMMTEWTPCSRTCGKGTQNRQIACTQQLRNGTLIRARERDCLGPKPASAQRCE
GQDCMTVWEAGVWSECSVKCGKGVRHRTVRCTNPRKKCVLSTRPKEAEDCEDYSKCYVWR
MGDWSKCSVTCGKGMQSRVIQCMHKITGRHGNECFSSEKPAAYRPCHLHPCNEKINVNTI
TSPRLAALTFKCLGDQWPVYCRVIREKNLCQDMRWYQRCCETCRDFYAQKMQQRS
Download sequence
Identical sequences E1C0E3
XP_413968.4.86415 ENSGALP00000000206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]