SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000000351 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000000351
Domain Number 1 Region: 159-403
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.36e-71
Family Nuclear receptor ligand-binding domain 0.00000000065
Further Details:      
 
Domain Number 2 Region: 50-139
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.64e-28
Family Nuclear receptor 0.00000767
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000000351   Gene: ENSGALG00000000270   Transcript: ENSGALT00000000352
Sequence length 415
Comment pep:known chromosome:Galgal4:27:4342652:4348356:1 gene:ENSGALG00000000270 transcript:ENSGALT00000000352 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQKPSTLDPLSEPEDTRWLDGKRKRKSSQCLVKSSMSGYIPSYLDKDEQCVVCGDKATG
YHYRCITCEGCKGFFRRTIQKNLHPTYSCKYDGCCVIDKITRNQCQLCRFKKCISVGMAM
DLVLDDSKRVAKRKLIEENRERRRKEEMIKSLQHRPSPSAEEWELIHVVTEAHRSTNAQG
SHWKQKRKFLPEDIGQSPMASMPDGDKVDLEAFSEFTKIITPAITRVVDFAKKLPMFSEL
PCEDQIILLKGCCMEIMSLRAAVRYDPESETLTLSGEMAVKREQLKNGGLGVVSDAIFDL
GKSLSAFNLDDTEVALLQAVLLMSSDRTGLICVDKIEKCQETYLLAFEHYINYRKHNIPH
FWPKLLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFEDPGGCRGPPPA
Download sequence
Identical sequences ENSGALP00000000351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]