SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000000599 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGALP00000000599
Domain Number - Region: 114-224
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000368
Family Galactose-binding domain 0.069
Further Details:      
 
Domain Number - Region: 15-69
Classification Level Classification E-value
Superfamily FlgN-like 0.012
Family FlgN-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000000599   Gene: ENSGALG00000000443   Transcript: ENSGALT00000000600
Sequence length 243
Comment pep:novel chromosome:Galgal4:25:205888:214237:-1 gene:ENSGALG00000000443 transcript:ENSGALT00000000600 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
THLLPHHYRCHHRHALSQEIERLQQAASELRAQRDCYQTPEIERLQQAASELRAQLDCYQ
TPDWALQSFGATIDTRRTSPIYELRSWFSRHCFWCSVNPPDTILQPGVSLGECWPMEGQQ
GQVVIRLRAKIRPSCVTLEHITPEMTPSGTASSAPRDVAVFGLDADSEEEVPLVSFTFDV
GEGPTQTFLLKNNHSRAFRYIKVLVKSNWGHPRYTCLYRVQVHGKVTPDWALQSLVRTQA
GKP
Download sequence
Identical sequences ENSGALP00000000599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]