SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000000619 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000000619
Domain Number 1 Region: 203-462
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.4e-89
Family Eukaryotic proteases 0.0000762
Further Details:      
 
Domain Number 2 Region: 504-763
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.35e-88
Family Eukaryotic proteases 0.0000883
Further Details:      
 
Domain Number 3 Region: 837-1089
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.1e-84
Family Eukaryotic proteases 0.00011
Further Details:      
 
Domain Number 4 Region: 49-123
Classification Level Classification E-value
Superfamily SEA domain 0.000000248
Family SEA domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000000619   Gene: ENSGALG00000000458   Transcript: ENSGALT00000000620
Sequence length 1091
Comment pep:known_by_projection chromosome:Galgal4:28:615634:627109:1 gene:ENSGALG00000000458 transcript:ENSGALT00000000620 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQIKPVLGRRGPRASCWKVTITATVVGGVTALYLGILLACHPAAETSFEHTVELRGITF
NSSLQAENSDYYRVLTPALERLFLSSFQDSQLDWSCTGCTILGYSRSGNSSVIVRFRLRF
APQDSQPLSSATEEEALRHGLAAALQEQGLSLAAFGTISSASLTGLQKTRVTRALLSPGS
CPGDMFMCHNTQCVWKENPECDGQKDCADASDEKGCDCGSRPAMQTASRIVGGTEASRGE
FPWQVSLRENNEHFCGAAILTEKWLVSAAHCFTEFQDPAMWAAYAGTTSISGADSSAVKM
GIARIIPHPSYNTDTADYDVAVLELKRPVTFTKYIQPVCLPHAGHHFPTNKKCLISGWGY
LKEDFLVKPEFLQKATVKLLDQALCSSLYSHALTDRMLCAGYLEGKIDSCQGDSGGPLVC
EEPSGKFFLAGIVSWGIGCAEARRPGVYTRVTKLRDWILDAISPFPTSITRTVPLTHSST
NSNVVTPEELSATTSTAIPTSSPALAASKPATAPRPQECGGRPGLSKPNKIVGGTDASRG
EIPWQVSLQEDSMHFCGATIIGDRWLLSAAHCFNETNPEEIEAYMGTTSLNGTDGSAVKV
NVTRVIPHPLFNPMLLDFDVAVLELARPLVFNKYIQPICLPLAVQKFPVGKKCIISGWGN
LQEGNVTMSESLQKASVGIIDQKTCNFLYNFSLTERMICAGFLEGKIDSCQGDSGGPLAC
EVTPGVFYLAGIVSWGIGCAQAKKPGVYSRITKLNDWILDTISQFPGPSTGAPSTSATAR
TTADILTLRPSTTATGPISETTPSEKAATTVQETSTALKSTEPAKPTQAPGAPATSVLHG
ASSSVPDCGLTTALAFSKIVGGSSAARGEWPWQVSLWLRQKEHKCGAVLIADRWLLSAAH
CFDIYSDPKMWVAFLGTPFLNGNDGKMEKIFRIYKHPFYNVYSLDYDVALLELSAPVRFS
STIKPICLPDNSHIFQEGARCFITGWGSTKEGGLMTKHLQKAAVNVIGDQDCKKFYPVQI
SSRMVCAGFPQGTVDSCSGDAGGPLACKEPSGRWFLAGITSWGYGCARPHFPGVYTKVTA
VQGWIAQNLKL
Download sequence
Identical sequences ENSGALP00000000619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]