SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000001299 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000001299
Domain Number 1 Region: 7-246
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.67e-63
Family Nuclear receptor ligand-binding domain 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000001299   Gene: ENSGALG00000000887   Transcript: ENSGALT00000001301
Sequence length 262
Comment pep:known chromosome:Galgal4:23:1806942:1809396:-1 gene:ENSGALG00000000887 transcript:ENSGALT00000001301 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDCERCQCQHEDKHSAILYTLLSQNLSHSPPHQRCLCHQRWTVCLRTPHITCQAASDVLV
KTISFMKNLPSFHLLPRGDQLLLLDSCWVPLFLLGLVQEMVTFEVMETPAPSMLEKILLD
GQSKRQEPEWTQPMLAAVQWLQCSLNTFWSLDLSPKEYAYLKGAILFNPDVPGLTASLYI
ESLQREAERALQEVVQILHPKDQDRFALILLITSTLKSIPPALITDLFFRPIIGNADIVE
LIVDMLYEITSWQPAPSPRMAL
Download sequence
Identical sequences F1NCW3
ENSGALP00000001299 NP_001026064.2.86415 ENSGALP00000001299 9031.ENSGALP00000001299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]