SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000001443 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000001443
Domain Number 1 Region: 444-663
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000000658
Family GUN4-associated domain 0.06
Further Details:      
 
Domain Number 2 Region: 5-151
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000085
Family APC10-like 0.032
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000001443
Domain Number - Region: 691-779
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0284
Family Spectrin repeat 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000001443   Gene: ENSGALG00000000978   Transcript: ENSGALT00000001445
Sequence length 950
Comment pep:known_by_projection chromosome:Galgal4:21:921681:932456:1 gene:ENSGALG00000000978 transcript:ENSGALT00000001445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPHKIGFIVVSSSGHEDGFSAKELMVHAPTVNGWRSPRLCQYPQEIVLQLVERCRIRKLQ
LLAHQYMISSKIEFFISESLPEYFAPYQSERFHRLGYVPLSDNEKTGFKARELKSVYMDA
VGQYLKLIFHKNYVNKYNLYSQVALVAINIIGDPADYSDDSNKYPSREKLIDHYLGSKSD
DPALDGTYLGKPDSISPLDDLAFDMYQDPEVAQIIRRLDEKKHEAVHQERYDYAKKLKQA
IADLQKVGERLGRYEVEKRYAVEKEDYDLAKKKKQQMDAYRLKVYQQLQLHNLLDAELMS
RKPPELPVEPVIYDDSLQRTKATNSPSCENTELQTSQGELWKAESLLEEKPADPTSPEPV
FRHQSTPPTLSHSTASREVFAQEEAEFLPYDERPLPAIQKHSEEAIRYLEPERTEGDISN
TPRSGITGEPEPLSEKALREASPAIEVFGEALVSGAYSKSWSYREDALLAVYKKLMEMSV
STPKEDLRNMLRAAIFLVRRAIKDIVSSVFQASLKLLKMIITQYVPKHKLGKLETSHCVE
KTLPGLLSRTGDSSSRLRIVAAKFIQEMALWSEVKPLQIVPVHLVQLLKPNSPTHLAMSR
VELVECLLKEMGTENSGFTISNVMKFATGALEHRVYEVRDVALRIIFGMYRKHKAAILEY
LPPDDASIRKTVLYKTLFDGFTKIDGKLSEAEMRAQKKAATEEAERQKKEEIKVLQGQLA
ALKEIQAEVQAGKEKESDFQKTKDQGYKSPQPAAAEIPDDHSSVANYLDNLCIFCGERNE
SFTEEGLDLHYWKRCPMLTRCEHCKQVVEIASLTEHLLTECDKKDSFGKCQRCSEAFPKD
ELPKHIKSRTCNAAKPEHVANHCPLCHDNFSPGEEAWKSHLMGMDGCAMNLRRLSTINKT
IPMQPGKTGGHYLKKASPSRTKVRPPSIGSKIPTPRGGPNKSSGKTYSKQ
Download sequence
Identical sequences E1C2W2
XP_004947417.1.86415 XP_015152575.1.86415 ENSGALP00000001443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]