SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000001605 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000001605
Domain Number 1 Region: 215-226,318-556
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.36e-51
Family Nuclear receptor ligand-binding domain 0.00018
Further Details:      
 
Domain Number 2 Region: 143-224
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.45e-27
Family Nuclear receptor 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000001605   Gene: ENSGALG00000001073   Transcript: ENSGALT00000001607
Sequence length 566
Comment pep:known_by_projection chromosome:Galgal4:17:9453953:9475017:-1 gene:ENSGALG00000001073 transcript:ENSGALT00000001607 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAACSAGPREERCFAAVRDLIRGDRRAEPRGLKPSAPVKAKRVHGGRRLAAGPALPAAVG
SRCAGAAGAGRGRGDSGAAAALLPTQDRSRGSARGWLLEPGHSTRPRERRAAIAASWRLW
TLRAAVHGSSPFSSLADDRVDQRTCLICGDRATGLHYGIISCEGCKGFFKRSICNKRVYR
CSRDKNCVMSRKQRNRCQYCRLLKCLQMGMNRKAIREDGMPGGRNKSIGPVQISEEEIER
IMSGQEFEGEANMSWSNNGDSDHSSPGNGVSESNQPSPVSTPSSSRSVELNGFAALRDQY
IGTPVSTHYQYLPHLFSYSAHSALVPPQARSLDPQSHSLINQLVSAEDLEPLGTPMLIED
GYKVTQAELFALLCRLADELLFRQIAWIKKLPFFCELSIKDYTCLLSSTWQELILLSSLT
VYSKQIFGDLADVTSKYSPSDDELHRFSEEGMEVMERLIYLFRKFNQLKVSNEEYACMKA
INFLNQDIRGLTNASQLEQLNKRYWYVCQDFTEYKYPHQPNRFPDLMMCLPEIRYIAGKM
VNVPLEQLPLLFKAVLHSCKTSVSKE
Download sequence
Identical sequences ENSGALP00000001605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]