SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000001637 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000001637
Domain Number 1 Region: 119-312
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.67e-30
Family Pentraxin (pentaxin) 0.0012
Further Details:      
 
Domain Number 2 Region: 693-985
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000128
Family Rhodopsin-like 0.021
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000001637
Domain Number - Region: 47-151
Classification Level Classification E-value
Superfamily C-type lectin-like 0.000367
Family C-type lectin domain 0.013
Further Details:      
 
Domain Number - Region: 354-390
Classification Level Classification E-value
Superfamily Tex N-terminal region-like 0.0196
Family Tex N-terminal region-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000001637   Gene: ENSGALG00000001094   Transcript: ENSGALT00000001639
Sequence length 1103
Comment pep:known_by_projection chromosome:Galgal4:17:9403856:9424535:1 gene:ENSGALG00000001094 transcript:ENSGALT00000001639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGLRPDSWFFSFLVGSLSRSLFASAALAENQTSKDFAPVMIETLRHMYEYVPTALDWWH
ADRFCDQRFAQLLFEPPDSEQSSFSKLLQSHHIKGSVWLNERDGVLHKPKWRRNHIVPVL
VFGDKTDTKYVKVLSDFPVLPAVTACAHLQWDTRTQEIATVFSYAVPAFINEFQLRGFVD
EEGFVRFALIVHGHHSPYLPVFRADGQWHHFCVTWQQENGTWAIYADGKRRASASGLCTV
GLAAPQAIYGQGTFIIGQDQDSLGGTFKAKESFSGNITDLHIWQKVLSMEQIENVRSCWM
VEQELVFGWSLNALEIESTVEEVTAQFLCPGPVEECRVFEVGSSGFRHTSCLQSLPFICC
YRKDAYWQLKKAQLESSHFLVSHVNMLAKRMVIPENIFTSNVQDMNLSVALSTLDVLATV
LRKEETPVESSDLLMVLQLLKQVADVEVQEREELEMLEQLGQYYVEVTELILEEQNIETW
SSISQAVRGPMAVVELCNRVVSLLAPLLTSGRTKITIQHQNVGMEVRKLELSSQQLSSET
YLIQSPEEDRPDFIEIPVEEMQRLKAKGLRRVTVKNMWFGYSSLQRCLPGPGSSAAFQDV
AASDGGQKYLSTAVRTAVISSTVLSDYQEISTSVRYRLQHHTQVPSPPQDLPDKLVGPIC
AFWNFSLSHVSPDAGGMWSTAGCSVVTSLPDSTVCFCNHTTNFAVLLQVYEIERTTKDEL
TLQTLTFIGCGVSFCALVVTFILFLVVGVPKSERTTVHKNLIFALAAAEALLMFSELAKT
NQVLCFLVTAFLHLSFMAAFSWMLVEGLLLWSKVVAVNMSEDRRMKFYYATGWGLPAITV
GLTLATSFNNYVADNYCWLNVQTNVIWAFVGPVLFILGVNTFVLFRVVMVTVSSARRRAK
MLTLNSSLENQIGIQIWATAKPILVLLPVLGLTWVCGILVHLSIIWAYIFIMLNSLQGLY
IFLVYAIYNSEVRNAIQRMKDKKKALSFTNCSHPINYLSSPRNTTSWETGKPSPAAESAS
SNHAQKDPPVKNITNRGNFGGKIPMGISSIMSPERPAVELTAFKSSGNISFFVFNLFYAN
TAFSDCIVEHRPEGGEQVMLAQT
Download sequence
Identical sequences ENSGALP00000001637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]