SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000001779 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000001779
Domain Number 1 Region: 88-159
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.39e-18
Family Complement control module/SCR domain 0.00048
Further Details:      
 
Domain Number 2 Region: 214-277
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.89e-16
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 3 Region: 148-215
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000473
Family Complement control module/SCR domain 0.00025
Further Details:      
 
Domain Number 4 Region: 23-85
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000135
Family Complement control module/SCR domain 0.00052
Further Details:      
 
Domain Number 5 Region: 348-403
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000222
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 6 Region: 281-339
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000153
Family Complement control module/SCR domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000001779   Gene: ENSGALG00000001175   Transcript: ENSGALT00000001781
Sequence length 451
Comment pep:known chromosome:Galgal4:26:2628625:2639856:1 gene:ENSGALG00000001175 transcript:ENSGALT00000001781 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVGVFALAVLLAGLGAARAQGSCTLPDKVQNAELTEDASTMSSFPVGTTVSYTCRPGYM
RIPGMPVSRTCGENLMWSQIETFCTARSCTHPGELQNGVVHVTDLTFGSAVTFSCEKGYR
LHGNRQISCVIQGKVVDWNGPLPLCDRVPCKPPPSIANGRYTEADNYVYQTTVTYSCDNV
RAGENPFSLVGSPSIFCTVDENSNGVWSGPPPQCKVVICDNPQVENGRKASGFASQYIYG
SSVRFECDPDYVLLGMDVISCTENGTWYPSLPTCKRISEDACGAPKISHGEVVPQKSVYL
RGESVQIRCSPRCAFPDGGTEVTVMCQGRNTWSSEPNCACDSEPSDFSPVISHGRIIEGK
KSVYSEGDSITIECYAGYTLHGAARIEYIGGGRWTPEVPVCKLSAYIIAIICMIVAVLVF
LAAFWIFKKFISQEGKSDSTPHTAKYTSCKA
Download sequence
Identical sequences F1P3M9
ENSGALP00000001779 ENSGALP00000041805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]