SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000002025 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000002025
Domain Number 1 Region: 579-842
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.77e-89
Family Eukaryotic proteases 0.000000365
Further Details:      
 
Domain Number 2 Region: 327-433
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-27
Family Spermadhesin, CUB domain 0.00069
Further Details:      
 
Domain Number 3 Region: 202-319
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-23
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 4 Region: 73-170
Classification Level Classification E-value
Superfamily SEA domain 0.000000000000589
Family SEA domain 0.013
Further Details:      
 
Domain Number 5 Region: 473-511
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000301
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 6 Region: 440-475
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000432
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 7 Region: 509-545
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000131
Family LDL receptor-like module 0.00093
Further Details:      
 
Domain Number 8 Region: 552-592
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000839
Family LDL receptor-like module 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000002025   Gene: ENSGALG00000001331   Transcript: ENSGALT00000002027
Sequence length 843
Comment pep:known_by_projection chromosome:Galgal4:24:1570927:1580862:1 gene:ENSGALG00000001331 transcript:ENSGALT00000002027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSDLSIVLPSLPSQDMNNLEEGVEFLPAMNSKKMEKRGPKRRVVVAILIIAFLLISLVTG
LLVWHFKYRNAPVQKVFTGHLRVLNREFIDAYENSSSPEFIMLAKKVKSTIEDIYRSQPD
IGPYHKETVITAFSEGSVIAYYLSEFIVPKYREEKLDRAMADKQSLVQRLNPRLRNPTLK
VESVVAFPADPSIAQTARDNSCLFALHAKEGEITSFNTPGFPHSPYPNNARCYWALRADA
NSVISLTFKTLDLEQCTDSSDYVKVYDSLSPVEPHALVRLCGNYAPSYNLTFLSSQNVML
VALITNKEGRYPGFKAEFFQLPKMKACGGTLRGESGTFTTPYYPAHYPPATDCVWNIEVP
STKNVKVRFNMFFVLEPGVPVSSCTKDYVQINSTRYCGERSQFVVASSTNRIAVQFHSDR
SYTDTGFSAEYLSYDSSDPCPGKFACNTGRCIEKSMRCDGWLDCVDGSDERSCTCTDQQF
RCQNGWCKPKFWVCDNVNDCGDNSDELQCSCANNSFKCNNGKCIPNTQKCDGKDDCGDGS
DEGTCSKAAQSTVACKSYTYKCRNGLCISKQNPECDGQKDCEDNSDEDNCNCGTRSYIKK
SRIVGGQNSDVGEWPWQVSLHAKSQGHVCGASLISETWLVSAAHCFLELQGIRYSDASLW
TAYLGLTNQSKRNDANVQMKQIKRIISHRSFNDYTYDYDIAVIELQSPVTFSAVVQPICL
PDSTHNFPVGKDLWVTGWGATVEGGSGSTILQKAEIRVINQTVCNRLLTDQLTERMMCVG
VLTGGVDACQGDSGGPLVSVENSGRMFLAGVVSWGDGCAQRNKPGVYSRLTALRTWIKQQ
TGL
Download sequence
Identical sequences ENSGALP00000002025 9031.ENSGALP00000002025 ENSGALP00000002025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]