SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000002088 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000002088
Domain Number 1 Region: 48-258
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.15e-51
Family Reprolysin-like 0.0015
Further Details:      
 
Domain Number 2 Region: 358-410
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000432
Family TSP-1 type 1 repeat 0.00032
Further Details:      
 
Domain Number 3 Region: 665-720
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000222
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 4 Region: 717-776
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000288
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000002088   Gene: ENSGALG00000001370   Transcript: ENSGALT00000002090
Sequence length 776
Comment pep:known_by_projection chromosome:Galgal4:24:1655304:1670221:-1 gene:ENSGALG00000001370 transcript:ENSGALT00000002090 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HGQEGGSSPGAEDDSKRVVKRLSRKERHGEKPEAAPGQPLRRARRFVSEARYVETLLVAD
ASMVRFYGEDVENHILTLMSMAARIYKHPSLKNAISLVVVKVLVVDEEAAGPEVSDNGGL
TLRNFCSWQQQFNPLSDRHPEHYDTAILLTRQDFCGHQGCDTLGVADIGTMCDRNKSCSV
IEDEGLQAAYTLAHELGHVLSMPHDDSKTCERLFGPLGKHHMMAPLFVHLNKSQPWSPCS
AMYLTEFLDGGHGDCLLDPPAQALSLPSELPGRGALYSLDQQCQQIFGKDFQHCPNTTEE
DVCAQLWCRTSSGEPLCHTKNGSLPWADGTPCMAGGLCWDGACLPQDALQPQVLQPAVDG
GWGAWSPWGSCSRTCGGGVQFSHRHCDHPRPQHGGRYCEGQRTRYQSCHTEECPQDGKSF
REQQCEKYNSYNFTDLEGNRLEWVPKYAGVSPRDRCKLFCRARGRSEFKVFEPKVIDGTL
CGPETLSICVHGQCIKAGCDHVVGSSKKLDKCGVCGGNGSTCRKISGSLNRSKYGYNDIV
TIPAGATNIDIKQRSHRGVRHDGNYLALRTLEGRYLLNGDFAISAMEQDILIKGTILKYS
GSMTTLERLQSFRQLPEPLTVQLLTIASEVFPPKVKYTFFIPKDIPFSKQKDKEKKSANV
IRPMLTSQWVLGDWSECSKTCGSGWQRRTVECRDVEGQPSATCDRALKPEDIKPCGDVPC
PLWRMGPWSPCSQTCGEGVRTRNASCIHYTGTVIAPEKCSSPGPPPATATCLLRQC
Download sequence
Identical sequences ENSGALP00000002088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]