SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000002138 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000002138
Domain Number 1 Region: 195-405
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.26e-54
Family Reprolysin-like 0.00099
Further Details:      
 
Domain Number 2 Region: 493-549
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000209
Family TSP-1 type 1 repeat 0.00048
Further Details:      
 
Domain Number 3 Region: 871-931
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000157
Family TSP-1 type 1 repeat 0.006
Further Details:      
 
Domain Number 4 Region: 822-872
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000209
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000002138   Gene: ENSGALG00000001407   Transcript: ENSGALT00000002140
Sequence length 931
Comment pep:known_by_projection chromosome:Galgal4:24:1673353:1682880:1 gene:ENSGALG00000001407 transcript:ENSGALT00000002140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPLLLPLLLGARALSAPPGDTAVVTPLRLDPDINGRPYFRRGPAEAVVFQLSAFGEDFY
LHLSPDAGFIAPAFAAHYLGSAPGASRPHHLRHCFYSGDVNADQESFAALSLCGGLRGAF
GYRGAEYTISPLPGAEHGGAHRLQRRNVAHPLGTSASRCAVGSGLTPGVLQALEKYRGRA
AGGKAGGRTKRFASVPRYVETLVVADESMVKFHGDDLQHYLLTLMATAARLYKHPSIRNP
IQISVVKFLLIGQDDKGPKVTSNAALTLRNFCAWQKKWNKVSDKHPEYWDTAILFTKQDL
CGATTCDTLGMADVGTMCDPKRSCSVIEDDGLPSAFTTAHELGHVFNMPHDNVKACEEVF
GRLKTNHMMSPTLIQIDRANPWSACSAAIITDFLDSGHGDCLLDQPSNPIPLPEDLPGTS
YSLNQQCELAFGVGSKPCPYMQYCAKLWCTGKARGQIVCQTRHFPWADGTGCGEGRFCLK
GACVERHNVSKYRVDGGWAKWAPYGTCSRTCGGGVQLAKRECTNPVPANGGSYCEGVRVK
YRSCNLEPCSAAVPGKSFREEQCEAFNGYGHSTNRLTASVSWVPKYSGVSPRDKCKLICR
ANGTGYFYVLAPKVVDGTPCSPDSTSVCVQGKCIKAGCDGKLGSKKKFDKCSVCGGDNKS
CKKVSGLFTKPMHGYNFVVVIPAGASNIDIRQRGYKGLISDDNYLALKNGQGKYLLNGHF
IVSAVERDLMVKGSVLRYSGTGTAVESLQAFKPIQEPLTLEVLSVGKMTPPRVRYSFYLP
KESKEDKTSYKKEGKAPPDLNNSVLSLSNRLDGGRPTYKRPSYKWAAGGWEACSVTCGSG
LQKRAVACHDSYGHPASECEAAQRPAEVRSCGEPCPAWEAGPWAPCSKSCGRGFKRRMLK
CVASGGRLLPRESCSFRRKPQELDFCTLRPC
Download sequence
Identical sequences E1BX45
9031.ENSGALP00000002138 ENSGALP00000002138 XP_417874.2.86415 ENSGALP00000002138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]