SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000002331 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000002331
Domain Number 1 Region: 2228-2321
Classification Level Classification E-value
Superfamily C-type lectin-like 4.39e-33
Family Link domain 0.00012
Further Details:      
 
Domain Number 2 Region: 1567-1722
Classification Level Classification E-value
Superfamily FAS1 domain 6.41e-27
Family FAS1 domain 0.0014
Further Details:      
 
Domain Number 3 Region: 509-648
Classification Level Classification E-value
Superfamily FAS1 domain 1.1e-26
Family FAS1 domain 0.0037
Further Details:      
 
Domain Number 4 Region: 1733-1878
Classification Level Classification E-value
Superfamily FAS1 domain 2.88e-24
Family FAS1 domain 0.0029
Further Details:      
 
Domain Number 5 Region: 967-1125
Classification Level Classification E-value
Superfamily FAS1 domain 7.46e-21
Family FAS1 domain 0.002
Further Details:      
 
Domain Number 6 Region: 391-496
Classification Level Classification E-value
Superfamily FAS1 domain 6.93e-17
Family FAS1 domain 0.0066
Further Details:      
 
Domain Number 7 Region: 1129-1261
Classification Level Classification E-value
Superfamily FAS1 domain 0.00000000000119
Family FAS1 domain 0.0079
Further Details:      
 
Domain Number 8 Region: 1462-1519
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000555
Family EGF-type module 0.058
Further Details:      
 
Domain Number 9 Region: 232-286
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000718
Family EGF-type module 0.023
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000002331
Domain Number - Region: 2115-2151
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000323
Family EGF-type module 0.065
Further Details:      
 
Domain Number - Region: 843-907,936-991
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000534
Family Growth factor receptor domain 0.0069
Further Details:      
 
Domain Number - Region: 2160-2195
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00149
Family EGF-type module 0.034
Further Details:      
 
Domain Number - Region: 1511-1545
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00167
Family EGF-type module 0.081
Further Details:      
 
Domain Number - Region: 2037-2156
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00596
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number - Region: 1379-1505
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0102
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number - Region: 199-235
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0109
Family EGF-type module 0.092
Further Details:      
 
Domain Number - Region: 1987-2029
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0335
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 110-151
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0452
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 1340-1381
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0628
Family EGF-type module 0.051
Further Details:      
 
Domain Number - Region: 278-310
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0722
Family EGF-type module 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000002331   Gene: ENSGALG00000001535   Transcript: ENSGALT00000002333
Sequence length 2321
Comment pep:known_by_projection chromosome:Galgal4:12:590128:637363:1 gene:ENSGALG00000001535 transcript:ENSGALT00000002333 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SFGSQGMGRCCVFLICSGCISFGEAELLKSMKCNVKMTYTSSTACTSCAAVPRMSCPKGW
MRATQGRGVRGCRYTVKLGENTLSQPGCYQICKKEIEEKKCCPGFWGTECYECPGGSENP
CSSHGTCLDGIQRNGTCICKEQYSGFACQNCRDGNRFGPDCQSVCDCVHGECNSDVAGKT
SCTCYGGYTGPRCDQEIPLCKSMRCEANSECVVKDGTAMCNCKLGYRKSGSVCVAQDPCT
SSPCSPFAVCKFLGPRKYECTCKEGYQGDGRVCQPINPCVDNNGGCPENSTNCIYKGPGQ
ASCVCKPGMIARPPSLECSSFASDCQTYFCDISSKCEINSHGNPSCVCKEGEIGDARSCY
KDLMSEINKLSSPGMFSRKLSTARKMFASGCSVLLTKYGPFTVFLPSLLPINDKMEFNGT
TAADLCRMHIVPGLHLIEDMAKAKTMWTLSGHRLTFSNQAYTKSFRYQDVPGELYNVLQP
DFPAANGIIHVVDTLRKKRNADNIGNPQKTIGEILASTEIFSRFETILENCGLPAILDGP
GPFTVFVPSNDGVDKLRDGRLIYLFTEGINKLQELVKHHIYASAAITVEKLIVMPHIVTM
ANQILSINISADGRILMDDSEIPLNLRNIVASNGIIHTVDGIFIPPSIIPIFPHRCNEEQ
HKIVTGSCVDCEAINSSVCPPGSREMELTPFPKECVYIHDPQGLNVLKRGCARYCNQTIV
KPGCCEGFFGPDCTPCPGGYTNPCYGRGNCSDGIDGNGNCQCFEGFKGIACHICSNPNKH
GENCDEDCGCVHGVCDNRPGSGGVCQSWSCKEGYTGKFCDRTSKNCGPSGLSQYCHQNAV
CSLNDTARCICMDGYEGDGFSCQPIDLCSQPERGGCSPNALCTSTGPGNATCQCNVGWTG
DGKACVAIDNCMQESRGNCHIHADCIYIGPGQSKCVCKRGYAGDGHNCDAINPCLMDNGG
CHDLAICVPLGGGERSCACPEGYVGDGMTCYGDVLKELAGSSHFAGFYGWVKQTGVSIPA
GTNVTVLVPSEEAIKSLNSSEKDFWLTPYMLPFLVRAHFLEGVFTDEKLKKYDRPELPTL
NPRTRWQINTESGVFTIQNASLVVSNIPASNGIIHILSKQVLLPPLGDVPPIPPGLQKQL
DAVASFSTFKKLLEQYQLIGKIESSEKYTVFVPGNNSIEEYCRAANVTQLDNETVQFHIV
LGEKLLPSDLRSGVHKNSMLGLSYWLMFYQNSTQKFVNNIPLDGKLFETRNGILIGVSQV
LQIQKNRCTANTTTIQKSRCGKCEKGIKCPPGSVLVEFPGSKNLPRCELRSGDTGCHFIC
AKVSLKSVCCPGYYGHMCEMCPGKPGQWCSGNGECLDGIEGSGECQCLEGFHGTACEMCE
VGRYGADCKSECACDNGICNDGLQGDGSCDCFPGWKGPTCQERIEVDLCNGTCHQMANCL
NASMDSPPMCFCSAGYTGNGTHCTEIDPCTIDHGGCSIHAVCTKVSPGERTCVCKEGYAG
DGTLCREIDLCLESSGNCHTNAECVKTGPGKVACNCLPGYSGDGVRRCNPINLCEQNNGG
CSPFGLCKYTGPGTRNCSCSWHSIGDGFTCRGKVYQELARIEDASVFFKMILAEKNKELS
GAGPFTVFVPRADFIGNSTTFEEWKSRGLLQELLRYHMVGCQKLLLSDLEAQESLTSLSG
HTIKITKKENSIYLNDEAKVVMSDIVGVNGVIHFINKILIPSDLVSRNISSQISQLNITE
AAETFGYTIYSKLLKDAELLPLISNPLHRPFTMLWPTDAAFNALPEKRQQWLYHREHRGM
LASYLKAHMIRDTKIVAGNMPQVKSVRTMHGSTVSFSCSRTHVGELLVGSGDAVIIQRHM
EFHGGIAYGIDRLLEPPDLGSRCDEFISVELKGSMESCGPCGFEPPCPAGSVQRGGTWGC
HYFENQLFRNTFLFRHNHPLRPSWSSSPWEPFRRHFSSRGPLKRGCRRNCISTQWVPQCC
KNHYGRDCQACPGGLEAPCGNRGTCDDSISGSGRCNCSQAFIGTSCELCAPGRYGPQCRE
CNCTEHGVCNGGLHGDGFCFCAEGWTGERCEVRLAVKPTCSPPCHPQASCRAGNLCECDM
HYEGDGRACTAIDMCSQDNGGCATHAACTQLGVNVSCTCAAGYWGDGYVCEPIDRCADGR
NGDCSEHAHCISTGPNKRRCECKRGYIGDGIQCLEEAVPPTDRCLDSNGQCHREAICTDL
HFHDKTMGVFHLQSPRKKYDFTYVQAQEACAAEGAALATFQQLAAAQQMGFHLCLVGWMD
NGTAGYPTAFPTPSCGSNHVGIVDYGPRNNLSETWDAFCYR
Download sequence
Identical sequences ENSGALP00000002331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]