SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000002345 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000002345
Domain Number 1 Region: 243-462
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.04e-56
Family Reprolysin-like 0.00039
Further Details:      
 
Domain Number 2 Region: 553-608
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000732
Family TSP-1 type 1 repeat 0.00037
Further Details:      
 
Domain Number 3 Region: 894-951
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000811
Family TSP-1 type 1 repeat 0.0057
Further Details:      
 
Domain Number 4 Region: 833-891
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000837
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 5 Region: 955-1009
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000131
Family TSP-1 type 1 repeat 0.0052
Further Details:      
 
Domain Number 6 Region: 1009-1062
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000157
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000002345   Gene: ENSGALG00000001544   Transcript: ENSGALT00000002347
Sequence length 1109
Comment pep:known_by_projection chromosome:Galgal4:28:1745352:1791963:-1 gene:ENSGALG00000001544 transcript:ENSGALT00000002347 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAIAWRLLIWTVTFTTTVCSFRGYMFQSQEEFLSSLDHYEIAFPIQVDQNGDFLTFDMRS
QLKQRPRRSLGSLPYEPSEQQVFYKVSAHRTQFLLNLTLHSNLLAEHFTVEYWKRDGVDW
QHDFHEDCHYAGHLQDQYLNSKVAISNCNGLHGVIVADEEEYFIEPLSPGANVSAGNEGK
GSPHVVYKRSSLQYPHMDAACGVLDEKPWKGRHWWLRTLKPSPLKPSGNHSQRGQLPLKR
SVSTERYVETLVVADKMMVGYHGRRDIEQYILAIMNIVAKLFQDSSLGNIVNILVTRLIL
LTEDQPTLEINHHAGKSLDSFCKWQKSIVNRNGNGNAIPENGIANHDTAVLITRYDICIY
KNKPCGTLGLAPVGGMCERERSCSINEDIGLATAFTIAHEIGHTFGMNHDGVGNSCGSRG
QETAKLMAAHITMKTNPFVWSTCSRDYITSFLDSGMGLCLNNAPPKQDFIYPTVAPGQAY
DADEQCRFQYGVKSRQCKYGEVCSELWCLSKSNRCITNSIPAAEGTICQTNTIEKGWCYK
RECVPFGTRPEGVDGAWGSWSSWGECSRTCGGGVSSSVRHCDSPRPTIGGKYCLGERKRY
RSCNTDDCPPGSQDFRELQCAEFDNVPFRGKYYTWKTYRGGGVKACSLNCLAEGFNFYTE
RAAAVVDGTPCRQDSNDICVNGECKHVGCDRVLGSDAKEDKCRVCGGDGSSCETIEGIFN
QSLPEGGYEEVIQIPKGSVHIDIRELNLSINYLALRGDAGEYYINGKLSIDPPRRFDIAG
TTFHYRRSPDEPESLEALGPTNVTLFVMVLVRTELQGIRYKFNAPISRDASNQYSWHYTP
WTKCSVLCAGGSQIQSVVCRKLSDSSTVSNHFCSPETKMLERQRPCNTEPCAPAWVIGNW
SECSRSCNEGVRTRSVFCKRKISATEEKTLDDASCTQPRPKMLEPCNNQTCPPEWVALDW
SECTPSCGPGFRHRIVLCKSGDHSATLPTSQCPEGSKPPTSMRCNLRRCPPPRWVTGEWG
ECSAHCGLGQQRRSVQCLAHTGQPSSDCLETLQPPGMQQCETKCESGPTDNPEECKDVNK
VAYCPLVLKFKFCSRTYFRQMCCKTCQGH
Download sequence
Identical sequences ENSGALP00000002345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]