SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000002436 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000002436
Domain Number 1 Region: 48-365
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.11e-101
Family Glycosyl hydrolases family 35 catalytic domain 0.0000606
Further Details:      
 
Domain Number 2 Region: 483-625
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.26e-28
Family Beta-galactosidase LacA, domains 4 and 5 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000002436   Gene: ENSGALG00000001604   Transcript: ENSGALT00000002439
Sequence length 636
Comment pep:known chromosome:Galgal4:24:2565767:2587102:1 gene:ENSGALG00000001604 transcript:ENSGALT00000002439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWPCGGRRQRRLGGVALLLLVLWLLARRFNWSELVPLRLWGRTLGLQTEHSQFLLEGMPF
RIFGGSVHYFRVPREYWEDRMLKMKACGLNTLTTYVPWNLHEQTRGKFDFSENLDLQAFL
SLAAKNGLWVILRPGPYICSEWDLGGLPSWLLQDPEMQLRTTYKGFTEAVDAYFDHLMPI
VVPLQYKRGGPIIAVQVENEYGSYAKDPNYMAYVKRALLSRGIVELLMTSDNKNGLSFGL
VEGALATVNFQKLEPGVLKYLDTVQRDQPKMVMEYWTGWFDNWGGPHYVFDADEMVNTVA
SILKLGASINLYMFHGGTNFGFMNGALKTDEYKSDVTSYDYDAVLTEAGDYTSKFFKLRQ
LFSTIIGQPLPLPPMIESKASYGAILLHQYISLWDVLPSLVQPIKSEFPVNMENLQLNDS
SGQSYGYVLYETVIFGGGHLHSRDHVRDRAQVFVNTMYVGELDYNTVELSLPEGQGFRQL
RLLVENRGRVNYGLALNEQRKGLIGDIFLNKTPLRNFKIYSLEMKPDFLKSLRHTAGWSA
VPDYFVGPAFFRGRLWIEHQPQDTFLKLQGWEKGVVFVNGHNLGRYWKIGPQETLYLPGP
WLQKGSNEIIIFEERTAGRIIQSVDIPYLGRTQYVD
Download sequence
Identical sequences ENSGALP00000002436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]