SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000002444 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000002444
Domain Number 1 Region: 821-899
Classification Level Classification E-value
Superfamily DEATH domain 3.36e-19
Family DEATH domain, DD 0.0000584
Further Details:      
 
Domain Number 2 Region: 132-223
Classification Level Classification E-value
Superfamily Immunoglobulin 3.64e-16
Family I set domains 0.016
Further Details:      
 
Domain Number 3 Region: 222-272
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000103
Family TSP-1 type 1 repeat 0.00062
Further Details:      
 
Domain Number 4 Region: 278-325
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000068
Family TSP-1 type 1 repeat 0.00092
Further Details:      
 
Domain Number 5 Region: 25-127
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000191
Family I set domains 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000002444   Gene: ENSGALG00000001608   Transcript: ENSGALT00000002447
Sequence length 924
Comment pep:known_by_projection chromosome:Galgal4:22:1850667:1902149:1 gene:ENSGALG00000001608 transcript:ENSGALT00000002447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGSAGNDNSEALPESIPSAPGTLPHFMEEPDDAYIIKSNPIVLRCKAMPAMQIFFKCNG
EWVHQNEHVSEESMDEATGLKVREVFINVTRQQVEDFHGPEDYWCQCVAWSHLGTSKSRK
ASVRIAYLRKNFEQDPQGKEVPIEGMIVLHCRPPEGVPAAEVEWLKNEEPIDSNLDENID
TRADHNLIIRQARLSDSGNYTCMAANIVAKRRSMSATVVVYVNGGWSSWTEWSNCNARCG
RGWQKRSRTCTNPAPLNGGAFCEGMSVQKITCTSLCPVDGNWEVWSEWSVCSPECEHLRV
RECIAPAPRNGGKYCEGLSQESENCTEGLCIQDKKPLHEIKSQNIETASDIALYSGLGAA
VIAVAVLVVGVTLYRRSQSEYGVDVIDSSALTGGFQTFNFKTVRQGNSLLLNSSMQPDLT
VSRTYSGPICLQDPMDKELMTESSLFNPLSDIKVKVQSSFMVSLGVTERAEYHGKAHSGT
FPHGNARGFGTIQARNKAAYIQNLSSISTRNELKTTAIFGHLGGRLVVPNTGVSLLVPHG
AIPEESSWEIYLAINPRESSLQPEGPDVLLGPEVTCGPSDVSVSSPFALTIPHCAEVNSE
HWNIHLKKRTQQGKWEEVMSVEEETTSCYCLLDPYACHILLNSFGTYALIGEPISECAVR
QLKVAVFGCLSCNSLDYNLRVYCMDNTPCAFQEVVLDERLQGGQLLDEPKLLHFKGNTFS
LQISVLDIPPFLWRIKPFTACQEVPFSRVWCSNQKPLHCAFSLERYTPATTQLSCKICVR
QVKGHEQILQIQTSILENERETIAFFAHDDSNFPAQMGAKAFKIPYSIRQRICATFDTPN
AKGKDWQMLAQKNSISRNLSYFATQSSPSAVILDLWEARHQHDGDLDSLACALEEIGRTH
SKISDITETEIEEPDFNYSRQNGL
Download sequence
Identical sequences ENSGALP00000002444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]