SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000002466 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGALP00000002466
Domain Number - Region: 235-319
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 0.0216
Family Mannose 6-phosphate receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000002466   Gene: ENSGALG00000001618   Transcript: ENSGALT00000002469
Sequence length 320
Comment pep:known_by_projection chromosome:Galgal4:18:3490216:3525947:1 gene:ENSGALG00000001618 transcript:ENSGALT00000002469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PEERQRAGGGRRPSRALPSPTSLLPSPRPGNAGPLEARGGRLWAACFVSAALVAAAGGLL
AWSSRSAEDGVAEVLARRGEPLLDKFVEVPCSGDYDGYRRFEGCTPRRCGRGVSDVVITR
EEAERIRRVAERGLSLGGSDGGASILDLHSGALSLGKQFVNLYRYFGDKIQGIFTEEDFA
LYRDVRQRIQQKIAQAFGISSSSMYLTKPTFFSRINSTEAKTTHDEYWHPHIDKVTYGSF
DYTSLLYLSDYAEDFGGGRFVFMDAGSNKTIEPQAGRVSFFTSGSENLHRVEKVHWGTRY
AITISFTCNPDHGIGDPVLM
Download sequence
Identical sequences ENSGALP00000002466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]