SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000002742 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000002742
Domain Number 1 Region: 149-426
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.09e-84
Family Eukaryotic proteases 0.000006
Further Details:      
 
Domain Number 2 Region: 39-100
Classification Level Classification E-value
Superfamily GLA-domain 1.04e-22
Family GLA-domain 0.00035
Further Details:      
 
Domain Number 3 Region: 88-168
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000518
Family Growth factor receptor domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000002742   Gene: ENSGALG00000001780   Transcript: ENSGALT00000002745
Sequence length 433
Comment pep:known chromosome:Galgal4:9:788897:797608:1 gene:ENSGALG00000001780 transcript:ENSGALT00000002745 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWKLITIGVLLAACSSPVCHASIFYSYKDANQVLKIRKRANSFLEELKPGSVERECNEEK
CNFEEASEIFETKEATLEFWSKYVDGDQCAQKPCSNGACKDNIGSYSCICDKGWEGAQCN
YEVKYNNCSVDNGGCQHFCKEDPAKQCRYCSCASGYQLTNDHNMCTPVVEFPCGRVKMDY
TEGKAEFNIRLIGGNSGGRGFSPWQVMLQNLKGKFLCGGVLIHPSWVLTAAHCVETGETL
KVRLGKYHRLRIENSEQTIRVDKYVRHENYTKLTSDNDIAMLHLAEPVMYNKYALPICLP
TRDLAEHELTTKGRQMLVTGWGSTSDEMRNYSALLSYIEIPIVPKNECAQVMTNTISDNM
LCAGSLGDRKDSCSGDSGGPMATKYKDTWFLVGLVSWGEGCGKKEKFGVYTKVSQYLEWI
QHHINKKSGSWRG
Download sequence
Identical sequences F1NGY6
ENSGALP00000002742 XP_015132296.1.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]