SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000002847 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000002847
Domain Number 1 Region: 20-252
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.46e-72
Family Eukaryotic proteases 0.0000453
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000002847   Gene: ENSGALG00000001842   Transcript: ENSGALT00000002851
Sequence length 300
Comment pep:known_by_projection scaffold:Galgal4:AADN03011125.1:876:2599:1 gene:ENSGALG00000001842 transcript:ENSGALT00000002851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAALLILSLGGSALGPAGAHSSWVIGGKAAVPHSRPFIASIQMDGQHFCGGFLVWPRWV
MTAAHCPVPRREPSVRVVLGAHSLEQPEESQQVFGVEESIAHPLYNPRTVDNDIRMLRLN
HTATLNAFVKRIRLPRPRIDLKPGTLCSVVGWGDISNYGERPIQLMEANTTIVKRSLCRT
LWKGRVSGNMLCGASRNATLQGVCAGDSGGPLVFKGKVYGVVSFSGERCGDRRYPDIYTR
ISNYIDWVHHVVLSHRQPPGQRKDKPGPEKAGGDQGAAGWGRPGFPRPPPAPRGLMFNGN
Download sequence
Identical sequences A0A1D5P6P8
XP_418216.3.86415 ENSGALP00000002847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]