SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000002963 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000002963
Domain Number 1 Region: 31-212,294-460
Classification Level Classification E-value
Superfamily L domain-like 8.75e-63
Family Ngr ectodomain-like 0.0011
Further Details:      
 
Domain Number 2 Region: 500-658,737-868
Classification Level Classification E-value
Superfamily L domain-like 6.81e-55
Family Ngr ectodomain-like 0.0008
Further Details:      
 
Domain Number 3 Region: 1137-1327
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-39
Family Laminin G-like module 0.0023
Further Details:      
 
Domain Number 4 Region: 991-1106
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000502
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 5 Region: 950-990
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000839
Family EGF-type module 0.02
Further Details:      
 
Domain Number 6 Region: 908-949
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000161
Family EGF-type module 0.0046
Further Details:      
 
Domain Number 7 Region: 1365-1401
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000261
Family EGF-type module 0.032
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000002963
Domain Number - Region: 1411-1439
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000322
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 1329-1361
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00122
Family EGF-type module 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000002963   Gene: ENSGALG00000001916   Transcript: ENSGALT00000002967
Sequence length 1519
Comment pep:known chromosome:Galgal4:13:3574865:4046215:1 gene:ENSGALG00000001916 transcript:ENSGALT00000002967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGGRSEFLCLGMILGFWSSVSWMPVGGCPHKCTCIASNVDCHGLGLKTVPRDIPRNAER
LDLEKNNITRITKMDFSGLKNLRVLHLEENQISVIERGAFQDLKQLERLRLNKNKLQVLP
ELLFQNTQKLTRLDLSENQIKGIPRKAFRGIIDVKNLQLDNNQISCIEDGAFRALRDLEI
LTLNNNNITRIPVTSFNHMPKIRTLRLHSNFLHCDCHLAWLSDWLRQRRTIGQFTFCLAP
VSLRGFLVAEVQKKDFVCSGSQSEPPSCSASSITCPSACTCSNNVVDCRGRGLTEIPANL
PEDIWEIRLEQNLIKVIPPGAFTQYKKLKRIDISKNQISEIAPDAFKGLKSLISLVLYGN
KITEIPQGLFDDLVSLQLLLLNANKINCLRVNTFQGLHNLKLLSLYDNKLQTISKGLFAP
LRSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGARCSNPRRLANKRISQIKSKKFRC
SGSEDYRSKFTGKCFMDLVCPEKCRCEGTVVDCSNQKLTRLPSHLPEYTTDLRLNDNDIS
VLEAIGLFKKLPNLRKINLSNNKIKEIREGTFDGASGVQELILTENQLESVHGRMFRGLT
GLKTLMLRSNSISCINNDTFAGLSSVRLLSLYDNHISTITPGAFSTLVSLSTINLLANSF
NCNCHLAWLGKWLRKKRIVSGNPRCLKPFFLKDIPIQDVDAQDFTCEGNDESSCLLSPPC
PSQCTCVDSVVRCSNKGLRVMPKGIPKDVTELYLEGNHLTAVPKGLSAFRHLTLIDLSNN
SISVLANYTFSNMTQLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFND
LVSLSHLALGTNPLHCDCNLRWLSEWVKAGYKEPGIARCSGPEAMVDRLLLTTPTHHFQC
KEPVDISVVSKCNPCLSNPCKNNGTCSNDPVEFYQCTCPFGFKGRDCSVPINSCIQNPCQ
NGGTCHLTEANKDGFSCSCPLGYEGERCEINPDDCEDNDCENNSTCVDGINNYVCLCPPN
YTGELCDEVINHCIPELNPCQHESKCVPLDKGSRCECLPGYSGKHCEIDDDDCVGHKCRH
GAVCVDAVNGYTCVCPQGFSGLFCETPPPMVLLQTSPCDNYECQNGAQCIVAHQEPVCRC
LAGFAGQKCEKLITVNFVGKDSYVELPSAKIRPQANISLQVATDKDNGILLYKGDNDPLA
LELYQGHVRLIYDTLNSPPTTVYSVETVNDGQFHSVELVMLNQTLNLVVDKGTPKSLGKL
QKQSSVSLNTPLYIGGIPTSTGLSSLRQGADKTPNGFHGCIHDVRINNELQDFKDLPQQS
IGVLPGCKSCNICKHGICRSLEKTSVVCECHPGWTGPLCDQEIGDPCLNHKCLHGKCMAA
NVAYTCKCMEGYTGTYCDKKNNSSNPCRILKCNHGQCKISEHGEPYCECDPNYSGDHCDR
ENLCQGEIIREVVRKQQGYTTCVTASKVPRMECHGSCGSGQCCVPLRSKRRKYFFQCVDG
STFTEELERHVECGCSKCS
Download sequence
Identical sequences XP_015149068.1.86415 XP_015149070.1.86415 XP_015149071.1.86415 ENSGALP00000002963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]