SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000003079 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000003079
Domain Number 1 Region: 140-208
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000057
Family Complement control module/SCR domain 0.00096
Further Details:      
 
Domain Number 2 Region: 196-239
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000578
Family EGF-type module 0.0066
Further Details:      
 
Domain Number 3 Region: 292-337
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000126
Family EGF-type module 0.01
Further Details:      
 
Domain Number 4 Region: 250-287
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000658
Family EGF-type module 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000003079   Gene: ENSGALG00000001979   Transcript: ENSGALT00000003083
Sequence length 490
Comment pep:known_by_projection chromosome:Galgal4:11:1189504:1194020:1 gene:ENSGALG00000001979 transcript:ENSGALT00000003083 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRGGHSAMSLHGGLWDSGVGLWVMWLQELGVGKGTPPRFHPDGAVVWGRMEYWCLVLAA
SPAAMLILLPGWVALCILQLALGSAQECPSHQQVLSTVRQMQKLLSAQEAAHLQGTRSLK
KQLSVLHSRIQRLAGKHNDTCPLLVVPLNGRKLGRSARVGHDVHFICNAGFQLVGSESRT
CRRDRTWSGTQPFCRSIDECSSNPCANGGTCVDGNQRYTCLCPRGWSGVSCQSPVYAYWV
TLSNSSFSRQPRCAEGRPGSRHCSCDAGFQMRAGGVCQDVDECQLFQPNPQTRICLHDCL
NLPGSYRCLCPPGYVLHADRNTCEDVDECTGSQHNCTHGELCINTFGGHRCVRPKCPPPR
HNTSYVKTSSFQCERNPCPTDSRACRLAATSISFHYLPLQANRTVPRVLFKMSTTRFVGD
SLRFAIIGGRGQGVFAVRRSDRQTGELVLSSPVVGPATLEVELEMSEFSRKVLLGKHIFK
VTAFVSQYEF
Download sequence
Identical sequences ENSGALP00000003079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]