SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000003259 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000003259
Domain Number 1 Region: 102-116,157-406
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.34e-63
Family Nuclear receptor ligand-binding domain 0.0000311
Further Details:      
 
Domain Number 2 Region: 32-117
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.24e-30
Family Nuclear receptor 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000003259   Gene: ENSGALG00000002093   Transcript: ENSGALT00000003264
Sequence length 406
Comment pep:known chromosome:Galgal4:10:896000:899679:1 gene:ENSGALG00000002093 transcript:ENSGALT00000003264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASPAGSVVSAGLEDSPSGLNPAPGKALSPVLLCKVCGDTSSGKHYGIYACNGCSGFFK
RSVRRKLIYRCQAGTGLCPVDKAHRNQCQACRLKKCLQAGMNKDAVQNERQPRSTAQVRL
DSIELDAELPPEHVAATRDVPPVPCPAPRGHGATAATAAVPRTPTPPTNHRFMASLMTAE
TCAKLEPEDVDETVDVTGGEPERAGSEYQVAPYPAAGPENVYETSARLLFMAVKWAKNLP
VFSNLPFRDQVILLEEAWSELFLLCAIQWSMPLESCPLLAVPEPSPGKLLPAAVDVRALQ
ETLGRFKALAVDPTEFACMKAVVLFKPETRGLKDPEQVENLQDQSQVMLGQHNRSHYPGQ
PVRFGKLLLLLPALRFLSSERVELLFFRRTIGNTPMEKLLCDMFKN
Download sequence
Identical sequences F1P0M4
ENSGALP00000003259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]