SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000003413 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000003413
Domain Number 1 Region: 152-166,301-539
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 9.18e-67
Family Nuclear receptor ligand-binding domain 0.00000000363
Further Details:      
 
Domain Number 2 Region: 84-167
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.96e-30
Family Nuclear receptor 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000003413   Gene: ENSGALG00000002182   Transcript: ENSGALT00000003418
Sequence length 541
Comment pep:known chromosome:Galgal4:8:1585806:1668861:-1 gene:ENSGALG00000002182 transcript:ENSGALT00000003418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSGSHTAIIQESIKHGLTSVGAGAADGHGAPSPARSRLVMLPKVETEALGLARSNGEQG
QMPENMQVSQFKMVNYSYDEDLEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRY
TCIENQNCQIDKTQRKRCPYCRFQKCLSVGMKLEAVRADRMRGGRNKFGPMYKRDRALKQ
QKKALIRANGLKLEAMTQVIQAMPTDLTISSAIQNIHSASKGLPLNHTALPPTDYDRSPF
VTSPISMTMPPHGSLQGYQTYGHFPSRAIKSEYPDPYTSSPESIMGYSYMDGYQTSSPAS
IPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLNTFGLMCKMADQTLFSIVEWA
RSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQVVHGKEGSILLVTGQQVDYSVIASQA
GATLNNLMSHAQELVAKLRSLQFDLREFVCLKFLVLFSLDVKNLENFQLVEGVQEQVNAA
LLDYTMCNYPQQTDKFGQLLLRLPEIRAISMQAEEYLYYKHLNGDVPCNNLLIEMLHAKR
A
Download sequence
Identical sequences ENSGALP00000003413 XP_015145729.1.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]