SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000003589 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000003589
Domain Number 1 Region: 435-647
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-30
Family Laminin G-like module 0.006
Further Details:      
 
Domain Number 2 Region: 662-861
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.03e-25
Family Laminin G-like module 0.0086
Further Details:      
 
Domain Number 3 Region: 883-1083
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-25
Family Laminin G-like module 0.011
Further Details:      
 
Domain Number 4 Region: 148-280
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000173
Family Growth factor receptor domain 0.0057
Further Details:      
 
Domain Number 5 Region: 1269-1308
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000175
Family EGF-type module 0.0051
Further Details:      
 
Domain Number 6 Region: 122-159
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000274
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 7 Region: 1112-1153
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000511
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 8 Region: 277-318
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000838
Family EGF-type module 0.011
Further Details:      
 
Domain Number 9 Region: 86-126
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000179
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 10 Region: 1109-1224
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000204
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 11 Region: 45-88
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000599
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 12 Region: 349-455
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000816
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 13 Region: 1239-1272
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000786
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000003589
Domain Number - Region: 4-30
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00956
Family EGF-type module 0.042
Further Details:      
 
Domain Number - Region: 897-931
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0132
Family EGF-type module 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000003589   Gene: ENSGALG00000002287   Transcript: ENSGALT00000003596
Sequence length 1377
Comment pep:known_by_projection chromosome:Galgal4:8:2476868:2538304:-1 gene:ENSGALG00000002287 transcript:ENSGALT00000003596 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRNDSRCLSNSCQKNSTCITGHRDDICRCVDMSLDTMEELCNKTSDPCSSNPCLQNATCL
SSAGNLNFTCECPDGYNGTTCEIAISMCDTNPCEHGGTCLDGLARPTCLCRTGFTGTRCE
MDVDECSSEPCHNGAVCRDGIDEYSCYCVPGYQGKHCDLEVNECVSDPCLNGATCLNLIG
RYYCICPLGYTGVNCELEVDECQSRPCQNGATCRDAPAAFSCSCPPGFLGALCQTDVDEC
ASGPCLHGALCADRPGGYSCNCTGTGFMGLHCESLVPPCWSQPCYNNATCEDSADGYTCH
CWPGYTGSHCETDISECSSAPCASGRCLERSWAARYGHEPALQLPFRHDRAEGYVCACPP
GIRGIHCDEDINECHTNPCQNGGICENFPGNYTCHCPPADKEGIFYGGWNCTEILRGCTD
QQCQNNGICIPHLKNGHHGFSCICSPGYTGIHCETVTTFSFQGNGFLWLKNPTTTKEESS
YNINLRFQTVQPTAFLFYRGEKDTFVKLELLNGYLHLSVQVKNQPRALLHISHNVSDGEW
HSVEVTLARAVTLNLLDSSCAESCVNKTSAMIDNDHVRLAFQSTFLGSLPVGNISSSSQL
NINNIHSTPSFVGCLQDIEIDLNVITPENASPESSLNVEAGCRKKDWCENHPCQNRGRCS
NLWLSYHCDCYRPYAGPSCAAEYIPGRFGSEDSSGYAAFSVDATENENLNISMFVRTRKS
SGLLLALRNSTSLYVRVYLEGGKLAMLAPNSIKLLGKHPINDGNFYLITLKIEPNMLELF
QSSQYLGFISTPVLTTQSKDFLYVGGLPDNRETDRNGGYFKGCIQDVRVNNQPLEFFSLT
NSLNSFINRTLINVTQGCSGDNLCKSSPCHNGGVCYSIWDDFTCTCPPNTAGKACEEVKW
CELGPCPHEAQCKLAHQGFECLANAVFSGRSSAIFYRSNGNIGRGLTNIVFGFRTRDKNV
ILLYAEKEPEFVIISIHNSKLVFQLQSGNNFYMLTLTSSLTVSDGKWHQVTVSMVEPLSQ
FSRWHMNIDNKDAATSTTATGSLNFLREETDIHLADKAFDNLDGLRGCMSTIEISGIYLS
YFENADILTKKPQEEQFLKISANPVLTGCLQEDACSSEPCMHEGTCEDLYTSYRCTCRPG
WVGTHCETNIDECFSNPCIHGNCTDGINSYECICEPGYTGLNCEEDIDYCQGHQCANGAT
CIDGINGYSCLCAGNFTGKLCRYRRLPYTVCGNEDRNLTCYNYGNCTDLGGKLACVCLPG
FAGERCEKDIDECSSDPCLNGGLCQNLLNKFHCLCDVNYAGDRCEIDLTTDLISNVFTSL
GSVTLALLILFLAVVVSVIAANKRSTQGTYSPSRQEKDGARVEMWSMVQPPPIERLI
Download sequence
Identical sequences ENSGALP00000003589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]