SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000003726 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000003726
Domain Number 1 Region: 581-655
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.75e-18
Family Complement control module/SCR domain 0.0054
Further Details:      
 
Domain Number 2 Region: 452-516
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.35e-16
Family Complement control module/SCR domain 0.0044
Further Details:      
 
Domain Number 3 Region: 273-327
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000101
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 4 Region: 524-584
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000105
Family Complement control module/SCR domain 0.00085
Further Details:      
 
Domain Number 5 Region: 206-269
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000537
Family Complement control module/SCR domain 0.0029
Further Details:      
 
Domain Number 6 Region: 393-449
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000405
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 7 Region: 152-214
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000783
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 8 Region: 90-147
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000121
Family Complement control module/SCR domain 0.0034
Further Details:      
 
Domain Number 9 Region: 29-94
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000275
Family Complement control module/SCR domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000003726   Gene: ENSGALG00000002369   Transcript: ENSGALT00000003734
Sequence length 660
Comment pep:known_by_projection chromosome:Galgal4:8:2632409:2639129:1 gene:ENSGALG00000002369 transcript:ENSGALT00000003734 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFKSYFFFLVMMNSGNIFAEDKLCDLPHVENGRIAPYYYSFKGYYFPMRKGKSLSYSCV
AGYTTETGTQDGRITCMAKGWSPVPRCYKKCNKPLLEHGVFYGTEMYFNIHEKLQYKCNQ
GYHAPSGGTEDTVQCQSDGWSSQASCTKTVESCQVPELHHGNYFTTQRELRVNEALLYKC
DEGYRTAGGNATEEAVCLAHGWSLTPNCSKKTCPSLGGIEHGGFYPMKKFYEEGDVVHFF
CEENYSFREFDLIQCYYFGWYPDPPACEDVTNKCPPPPLPPNAHIIADRRMYRSGDRVRI
QCQSGYEIRGSGEIRCEKGKWTSPPICMGSTDKKESETPAVEANATIRASKTYHSEETLA
FNCNHFVLLPLLLSECANSGVFWVIVDCVKIQQNCTSPPVIKNGVLLAPLLPSYKHGNSI
EYGCQRYHLLDGPSTVYCKRGNWTERPTCLDPCILNVTEMNSNNIELKWRQEEFVFLHGD
LIEFECKQGYKFPHVTVPSPGRTWCDRGRLKYPKCVFQVPMEKCDSPPSIANGALTLPPL
TQYDNGSSVQYSCSEYYFLQGSERIYCSEGQWTSPPLCIEPCTLSKNEMEKNNVLLESFY
EDQVYFYHGDYVGFHCKQNHFGAESDATLFQVQCKRGQLAYPRCVERRNLSLSWHSTLRI
Download sequence
Identical sequences ENSGALP00000003726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]